PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C011296P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 97aa MW: 10777.1 Da PI: 9.2112 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 55.3 | 1.3e-17 | 63 | 96 | 1 | 34 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT--- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpv 34 ++Dgy+WrKYGqK k+++ pr+Y++C+s+gCpv MELO3C011296P1 63 VKDGYKWRKYGQKITKDNQSPRAYFKCSSPGCPV 96 58******************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.7E-16 | 55 | 96 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 17.144 | 58 | 96 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.75E-15 | 59 | 96 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.0E-6 | 63 | 96 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.9E-12 | 64 | 96 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 97 aa Download sequence Send to blast |
MLKVVSIKNL VSQVDVCSRD HDQNDEGSRS ERADLRVSPP TLETSSTTQA YATTSFKDQA 60 LMVKDGYKWR KYGQKITKDN QSPRAYFKCS SPGCPV* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681823 | 2e-97 | LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014. | |||
GenBank | LN713257 | 2e-97 | LN713257.1 Cucumis melo genomic chromosome, chr_3. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016899977.1 | 5e-67 | PREDICTED: probable WRKY transcription factor 40 | ||||
TrEMBL | A0A1S4DVG5 | 1e-65 | A0A1S4DVG5_CUCME; probable WRKY transcription factor 40 | ||||
STRING | XP_008445263.1 | 3e-66 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF7398 | 30 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G31800.2 | 8e-17 | WRKY DNA-binding protein 18 |