PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C011135P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 97aa MW: 10508.8 Da PI: 4.5126 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 42.2 | 2.2e-13 | 4 | 51 | 54 | 101 |
DUF260 54 redamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101 r +a+++l++eA++r++dP+yG+vg+i++lq +l+ ++++la++++++ MELO3C011135P1 4 RGEAAETLYFEAKCRIEDPIYGCVGIISQLQYELHVAETQLAKTRAQI 51 7899***************************************99885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 9.703 | 1 | 51 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.3E-11 | 4 | 48 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 97 aa Download sequence Send to blast |
MDVRGEAAET LYFEAKCRIE DPIYGCVGII SQLQYELHVA ETQLAKTRAQ IALLASNLQQ 60 AQHEAQAFAF DDPSSGPICI GLSTPAHWLH SSFSDS* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681823 | 1e-162 | LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014. | |||
GenBank | LN713257 | 1e-162 | LN713257.1 Cucumis melo genomic chromosome, chr_3. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008439169.1 | 2e-36 | PREDICTED: LOB domain-containing protein 24-like | ||||
Swissprot | P59468 | 2e-16 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | A0A0A0LLX6 | 7e-48 | A0A0A0LLX6_CUCSA; Uncharacterized protein | ||||
STRING | XP_008445577.1 | 4e-65 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3697 | 30 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 3e-17 | LOB domain-containing protein 24 |