PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C008942P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 103aa MW: 12208.5 Da PI: 11.4126 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91.6 | 3.8e-29 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtfskRrng++KKA+ELS+LCd+++a+i+fs++g+l +s MELO3C008942P1 9 KRIENTTNRQVTFSKRRNGLIKKAYELSILCDIDIALIMFSPSGRLSQFS 58 79*********************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.871 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.5E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.36E-31 | 2 | 83 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.39E-35 | 2 | 75 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.8E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010152 | Biological Process | pollen maturation | ||||
GO:0080092 | Biological Process | regulation of pollen tube growth | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
MGRVKLQIKR IENTTNRQVT FSKRRNGLIK KAYELSILCD IDIALIMFSP SGRLSQFSGR 60 RRIEDVLARY INLPDHDRGR YTHFFLFLVF LFFKKKSFFL KM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 2e-19 | 1 | 86 | 1 | 85 | MEF2 CHIMERA |
6bz1_B | 2e-19 | 1 | 86 | 1 | 85 | MEF2 CHIMERA |
6bz1_C | 2e-19 | 1 | 86 | 1 | 85 | MEF2 CHIMERA |
6bz1_D | 2e-19 | 1 | 86 | 1 | 85 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681882 | 1e-98 | LN681882.1 Cucumis melo genomic scaffold, anchoredscaffold00010. | |||
GenBank | LN713262 | 1e-98 | LN713262.1 Cucumis melo genomic chromosome, chr_8. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008442144.1 | 5e-51 | PREDICTED: agamous-like MADS-box protein AGL66 | ||||
Refseq | XP_011654394.1 | 5e-51 | PREDICTED: MADS-box transcription factor 18-like | ||||
Swissprot | Q9LM46 | 2e-42 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
TrEMBL | A0A1S3B5T1 | 1e-49 | A0A1S3B5T1_CUCME; agamous-like MADS-box protein AGL66 | ||||
STRING | XP_008442144.1 | 2e-50 | (Cucumis melo) | ||||
STRING | XP_004146412.1 | 1e-50 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G22130.1 | 1e-42 | AGAMOUS-like 104 |
Publications ? help Back to Top | |||
---|---|---|---|
|