PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MELO3C008942P1

Organism

Cucumis melo

Taxonomic ID

3656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

M-type_MADS

Protein Properties

Length: 103aa MW: 12208.5 Da PI: 11.4126

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MELO3C008942P1	genome	MELONOMICS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	91.6	3.8e-29	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtfskRrng++KKA+ELS+LCd+++a+i+fs++g+l +s MELO3C008942P1 9 KRIENTTNRQVTFSKRRNGLIKKAYELSILCDIDIALIMFSPSGRLSQFS 58 79*********************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	29.871	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.5E-38	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	5.36E-31	2	83	IPR002100	Transcription factor, MADS-box
CDD	cd00265	6.39E-35	2	75	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-27	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.8E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-27	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010152	Biological Process	pollen maturation
GO:0080092	Biological Process	regulation of pollen tube growth
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 103 aa Download sequence Send to blast
MGRVKLQIKR IENTTNRQVT FSKRRNGLIK KAYELSILCD IDIALIMFSP SGRLSQFSGR 60 RRIEDVLARY INLPDHDRGR YTHFFLFLVF LFFKKKSFFL KM*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6bz1_A	2e-19	1	86	1	85	MEF2 CHIMERA
6bz1_B	2e-19	1	86	1	85	MEF2 CHIMERA
6bz1_C	2e-19	1	86	1	85	MEF2 CHIMERA
6bz1_D	2e-19	1	86	1	85	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269\|PubMed:19211705}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681882	1e-98	LN681882.1 Cucumis melo genomic scaffold, anchoredscaffold00010.
GenBank	LN713262	1e-98	LN713262.1 Cucumis melo genomic chromosome, chr_8.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008442144.1	5e-51	PREDICTED: agamous-like MADS-box protein AGL66
Refseq	XP_011654394.1	5e-51	PREDICTED: MADS-box transcription factor 18-like
Swissprot	Q9LM46	2e-42	AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBL	A0A1S3B5T1	1e-49	A0A1S3B5T1_CUCME; agamous-like MADS-box protein AGL66
STRING	XP_008442144.1	2e-50	(Cucumis melo)
STRING	XP_004146412.1	1e-50	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22130.1	1e-42	AGAMOUS-like 104

Publications ? help Back to Top
Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]