PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C007458P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 153aa MW: 17878.4 Da PI: 10.2668 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.5 | 1.2e-32 | 70 | 128 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++ +prsYYrCt ++C+vkk+ver a+dp++v++tYeg+H h+ MELO3C007458P1 70 LDDGYKWRKYGQKVVKNTLHPRSYYRCTEENCKVKKRVERLADDPRMVITTYEGRHAHS 128 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.6E-34 | 55 | 128 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.66E-29 | 62 | 129 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.31 | 65 | 130 | IPR003657 | WRKY domain |
SMART | SM00774 | 7.5E-38 | 70 | 129 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.9E-26 | 71 | 127 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MQVREIRDER GLSFMRGRNA IGNYGGDDDK ENDGKPRLRV STMKMKRIKG RKKVREPRFS 60 FKTMTDVDVL DDGYKWRKYG QKVVKNTLHP RSYYRCTEEN CKVKKRVERL ADDPRMVITT 120 YEGRHAHSPS DHNLEDPIMG HLPSSHLTSF FC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-27 | 61 | 127 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 4e-27 | 61 | 127 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | GU984031 | 0.0 | GU984031.1 Cucumis sativus WRKY protein (WRKY43) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016899208.1 | 1e-107 | PREDICTED: probable WRKY transcription factor 12 isoform X1 | ||||
Swissprot | Q9SVB7 | 4e-52 | WRK13_ARATH; Probable WRKY transcription factor 13 | ||||
TrEMBL | A0A1S4DTC3 | 1e-105 | A0A1S4DTC3_CUCME; probable WRKY transcription factor 12 isoform X1 | ||||
STRING | XP_008440122.1 | 1e-106 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4079 | 33 | 61 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G39410.1 | 2e-54 | WRKY DNA-binding protein 13 |