PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C007181P2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 243aa MW: 28043.8 Da PI: 10.0855 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.3 | 1.5e-31 | 25 | 74 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ MELO3C007181P2 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 74 79***********************************************8 PP | |||||||
2 | K-box | 113 | 2.9e-37 | 93 | 189 | 4 | 100 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 s++ s++ea+++ +qqe+akL+ +i nLq+++R++lGe+L+sL+ k+L+ Le++Lek++++iRskKnell+++ie+++++e +l+++n++Lr+k+ MELO3C007181P2 93 SNTGSTSEANTQFYQQEAAKLRVQIGNLQNSNRNMLGESLSSLTAKDLKGLETKLEKGISRIRSKKNELLFAEIEYMRRREIDLHNNNQMLRAKI 187 3444499***************************************************************************************9 PP K-box 99 ee 100 +e MELO3C007181P2 188 AE 189 86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.1E-42 | 17 | 76 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 34.132 | 17 | 77 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.12E-46 | 18 | 94 | No hit | No description |
SuperFamily | SSF55455 | 1.44E-33 | 18 | 92 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-33 | 19 | 39 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 19 | 73 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.0E-27 | 26 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-33 | 39 | 54 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-33 | 54 | 75 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 4.6E-28 | 100 | 187 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.921 | 103 | 193 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0048440 | Biological Process | carpel development | ||||
GO:0048443 | Biological Process | stamen development | ||||
GO:0048497 | Biological Process | maintenance of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 243 aa Download sequence Send to blast |
MFQNQEEKMS DSPQRKMGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA 60 LIVFSSRGRL YEYANNSVKA TIDRYKKASS DSSNTGSTSE ANTQFYQQEA AKLRVQIGNL 120 QNSNRNMLGE SLSSLTAKDL KGLETKLEKG ISRIRSKKNE LLFAEIEYMR RREIDLHNNN 180 QMLRAKIAES ERNVNMMGGE FELMQSHPYD PRDFFQVNGL QHNHQYPRQD NMALQLFNNK 240 MV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 3e-21 | 17 | 89 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-21 | 17 | 89 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-21 | 17 | 89 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-21 | 17 | 89 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_A | 3e-21 | 17 | 89 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-21 | 17 | 89 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-21 | 17 | 89 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-21 | 17 | 89 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-21 | 17 | 89 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-21 | 17 | 89 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00609 | ChIP-seq | Transfer from AT4G18960 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF022379 | 0.0 | AF022379.1 Cucumis sativus agamous-like putative transcription factor (CAG3) mRNA, complete cds. | |||
GenBank | AF035438 | 0.0 | AF035438.1 Cucumis sativus MADS box protein CUM1 (CUM1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008439700.1 | 1e-175 | PREDICTED: floral homeotic protein AGAMOUS isoform X1 | ||||
Refseq | XP_008439701.1 | 1e-175 | PREDICTED: floral homeotic protein AGAMOUS isoform X2 | ||||
Swissprot | Q43585 | 1e-126 | AG_TOBAC; Floral homeotic protein AGAMOUS | ||||
TrEMBL | A0A1S3AZC2 | 1e-174 | A0A1S3AZC2_CUCME; floral homeotic protein AGAMOUS isoform X1 | ||||
TrEMBL | A0A1S3B000 | 1e-174 | A0A1S3B000_CUCME; floral homeotic protein AGAMOUS isoform X2 | ||||
STRING | XP_008439700.1 | 1e-175 | (Cucumis melo) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18960.1 | 1e-106 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|