PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C006078P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 180aa MW: 20962.8 Da PI: 9.8163 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 99.7 | 1.9e-31 | 92 | 150 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk s +prsYY+Ct+ +C+vkk+++r ++d ++v++tYeg Hnh+ MELO3C006078P1 92 LDDGYRWRKYGQKAVKHSLYPRSYYKCTYVTCNVKKQIQRLSKDRSIVVTTYEGIHNHP 150 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.7E-31 | 79 | 150 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.83E-27 | 84 | 150 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 27.76 | 87 | 152 | IPR003657 | WRKY domain |
SMART | SM00774 | 8.5E-35 | 92 | 151 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.7E-24 | 93 | 150 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MEEEHHQLQQ PSPPPPPCSD PLATSLEIDW IAVLYGQEAI GDLPPASSTC ESSERRRDEE 60 KTNRRKNGGR RWRKAAGRRR FEFQTRSTED ILDDGYRWRK YGQKAVKHSL YPRSYYKCTY 120 VTCNVKKQIQ RLSKDRSIVV TTYEGIHNHP SHILMQTLTP LLKQIHTSFP LSKLFMNYN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-24 | 83 | 149 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-24 | 83 | 149 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681848 | 0.0 | LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006. | |||
GenBank | LN713260 | 0.0 | LN713260.1 Cucumis melo genomic chromosome, chr_6. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008437983.1 | 1e-134 | PREDICTED: probable WRKY transcription factor 75 | ||||
Swissprot | Q8VWQ4 | 3e-42 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
Swissprot | Q9FFS3 | 2e-42 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
TrEMBL | A0A1S3AVD5 | 1e-132 | A0A1S3AVD5_CUCME; probable WRKY transcription factor 75 | ||||
STRING | XP_008437983.1 | 1e-133 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3227 | 34 | 71 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46130.1 | 9e-45 | WRKY DNA-binding protein 43 |