PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C005393P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 161aa MW: 18781.7 Da PI: 10.2948 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.5 | 2.7e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtfskRrng+lKKA+ELSvLCdaev+viifs++g+lye+ss MELO3C005393P1 9 KRIENSTSRQVTFSKRRNGLLKKAYELSVLCDAEVSVIIFSQKGRLYEFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 51.6 | 4.1e-18 | 82 | 156 | 9 | 83 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 +e +++l+qe++ k+ie+L+++q +llG +L+s+s++eL+++e+qL sl++iR++K +l+++q e+l +k MELO3C005393P1 82 RSEGYMQQLKQEAEMTAKKIEQLEKSQQKLLGRGLDSCSFEELREIERQLVLSLTRIRETKAQLFKDQKEKLIEK 156 677789***************************************************************998665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 6.4E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.562 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.50E-42 | 3 | 72 | No hit | No description |
SuperFamily | SSF55455 | 1.83E-33 | 3 | 78 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.6E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.616 | 87 | 160 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 7.5E-17 | 88 | 156 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009838 | Biological Process | abscission | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0080187 | Biological Process | floral organ senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
MVRGKVEMKR IENSTSRQVT FSKRRNGLLK KAYELSVLCD AEVSVIIFSQ KGRLYEFSSS 60 DMQKTIERYR KHGKEGQSNP FRSEGYMQQL KQEAEMTAKK IEQLEKSQQK LLGRGLDSCS 120 FEELREIERQ LVLSLTRIRE TKAQLFKDQK EKLIEKIIVQ * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 5e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 5e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
1tqe_R | 5e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
1tqe_S | 5e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
5f28_A | 5e-21 | 1 | 78 | 1 | 78 | MEF2C |
5f28_B | 5e-21 | 1 | 78 | 1 | 78 | MEF2C |
5f28_C | 5e-21 | 1 | 78 | 1 | 78 | MEF2C |
5f28_D | 5e-21 | 1 | 78 | 1 | 78 | MEF2C |
6c9l_A | 5e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_B | 5e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_C | 5e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_D | 5e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_E | 5e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_F | 5e-21 | 1 | 78 | 1 | 78 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00576 | DAP | Transfer from AT5G62165 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681895 | 1e-96 | LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005. | |||
GenBank | LN713263 | 1e-96 | LN713263.1 Cucumis melo genomic chromosome, chr_9. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008467251.1 | 1e-109 | PREDICTED: MADS-box protein AGL42-like | ||||
Refseq | XP_016903703.1 | 1e-109 | PREDICTED: MADS-box protein AGL42-like | ||||
Swissprot | Q9FIS1 | 7e-69 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A1S4E646 | 1e-108 | A0A1S4E646_CUCME; MADS-box protein AGL42-like | ||||
STRING | XP_008467250.1 | 1e-108 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF666 | 30 | 102 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 3e-71 | AGAMOUS-like 42 |