PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C002290P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 168aa MW: 18814.3 Da PI: 8.3613 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 140.8 | 4.4e-44 | 13 | 112 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk+FGasnv kll+++ +++r+da+ sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+ MELO3C002290P1 13 PCAACKFLRRKCLAGCVFAPYFPPEEPQKFANVHKVFGASNVAKLLNEVLPHQRQDAVVSLAYEAEARIRDPVYGCVGAISFLQKQVQRLQKELD 107 7*********************************************************************************************9 PP DUF260 96 llkee 100 ++k++ MELO3C002290P1 108 AAKAR 112 99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:3.40.50.1820 | 5.4E-4 | 2 | 142 | IPR029058 | Alpha/Beta hydrolase fold |
PROSITE profile | PS50891 | 26.795 | 12 | 113 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.3E-43 | 13 | 110 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MGSTTTGNHY YSPCAACKFL RRKCLAGCVF APYFPPEEPQ KFANVHKVFG ASNVAKLLNE 60 VLPHQRQDAV VSLAYEAEAR IRDPVYGCVG AISFLQKQVQ RLQKELDAAK ARLFLYSCTD 120 FSTPFLPQYP QIINTPHHPL IWNSNYSNNN NNHDDINNPS MYFNGGI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-62 | 12 | 122 | 10 | 120 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-62 | 12 | 122 | 10 | 120 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681932 | 0.0 | LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001. | |||
GenBank | LN713266 | 0.0 | LN713266.1 Cucumis melo genomic chromosome, chr_12. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022924080.1 | 2e-91 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Swissprot | Q9FML4 | 8e-63 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A0A0LTL0 | 1e-102 | A0A0A0LTL0_CUCSA; Uncharacterized protein | ||||
STRING | XP_004157828.1 | 3e-95 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF24471 | 3 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 2e-65 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|