PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C000615P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 131aa MW: 13506.9 Da PI: 4.3109 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 36.3 | 1.5e-11 | 95 | 130 | 1 | 36 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevsk 36 rW++qe+laL+++r+em++ +r++ lk+plW+evs+ MELO3C000615P1 95 RWPRQETLALLKIRSEMDSVFRDATLKGPLWDEVSR 130 8*********************************96 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 131 aa Download sequence Send to blast |
MEPPAPGSGL PDPSQLFRVV STPPPPPSLT VDTTISDSQQ VEAASPISSR PPAVPSSYEE 60 LIRLGGGGGA GHMVVDDDEA DGRSGGGSGG SGGNRWPRQE TLALLKIRSE MDSVFRDATL 120 KGPLWDEVSR * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that binds specific DNA sequence such as GT3 box 5'-GGTAAA-3' in the SDD1 promoter. Negative regulator of water use efficiency (WUE) via the promotion of stomatal density and distribution by the transcription repression of SDD1. Regulates the expression of several cell cycle genes and endoreduplication, especially in trichomes where it prevents ploidy-dependent plant cell growth. {ECO:0000269|PubMed:19717615, ECO:0000269|PubMed:21169508}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by water stress. {ECO:0000269|PubMed:21169508}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN687016 | 0.0 | LN687016.1 Cucumis melo genomic scaffold, unassembled_sequence34520. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011654662.1 | 2e-58 | PREDICTED: trihelix transcription factor GTL1 isoform X1 | ||||
Refseq | XP_011654663.1 | 7e-59 | PREDICTED: trihelix transcription factor GTL1 isoform X2 | ||||
Swissprot | Q9C882 | 3e-17 | GTL1_ARATH; Trihelix transcription factor GTL1 | ||||
TrEMBL | A0A2K1YKF9 | 7e-25 | A0A2K1YKF9_POPTR; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF21033 | 4 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G33240.1 | 3e-20 | GT-2-like 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|