PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cla022657 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 154aa MW: 17925.2 Da PI: 7.1641 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 30.4 | 6.8e-10 | 74 | 110 | 19 | 55 |
HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 +k +yps++e+ LA+++gL+++q+ +WF N+R ++ Cla022657 74 HNKWPYPSEAEKLALAESTGLDQKQINNWFINQRKRH 110 34679*****************************985 PP | |||||||
2 | ELK | 37.6 | 4.6e-13 | 30 | 51 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++Ll+KYsgyL+sLkqE+s Cla022657 30 ELKNHLLKKYSGYLSSLKQELS 51 9*******************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03789 | 2.2E-10 | 30 | 51 | IPR005539 | ELK domain |
SMART | SM01188 | 1.0E-6 | 30 | 51 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 11.243 | 30 | 50 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 13.2 | 50 | 113 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 5.13E-20 | 51 | 122 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 4.4E-14 | 52 | 117 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 3.7E-27 | 55 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 4.47E-12 | 62 | 114 | No hit | No description |
Pfam | PF05920 | 1.3E-16 | 70 | 109 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 88 | 111 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MGSSSEEEEK GGEMEREIED QIDPRAEERE LKNHLLKKYS GYLSSLKQEL SKKKKKGKLP 60 KDARQELLRW WELHNKWPYP SEAEKLALAE STGLDQKQIN NWFINQRKRH WKPSEDVQFM 120 GMEGFCHPNA AAAAAAAFYF DGHFMGDSHY RLGP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state, and its expression disappears at the same time the shoot apex undergoes the transition from vegetative to reproductive development (PubMed:11934861). Positive regulator of LATERAL ORGAN BOUNDARIES (LOB) (PubMed:11934861). Probably binds to the DNA sequence 5'-TGAC-3' (PubMed:11934861). Able to traffic from the L1 to the L2/L3 layers of the meristem, presumably through plasmodesmata (PubMed:12900451). {ECO:0000269|PubMed:11934861, ECO:0000269|PubMed:12900451, ECO:0000269|PubMed:7866029}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by ASYMMETRIC LEAVES1 (AS1) and ASYMMETRIC LEAVES2 (AS2). |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681823 | 3e-81 | LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014. | |||
GenBank | LN713257 | 3e-81 | LN713257.1 Cucumis melo genomic chromosome, chr_3. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023547276.1 | 1e-84 | homeotic protein knotted-1-like | ||||
Swissprot | P46639 | 2e-69 | KNAT1_ARATH; Homeobox protein knotted-1-like 1 | ||||
TrEMBL | A0A1S3BA00 | 4e-80 | A0A1S3BA00_CUCME; homeobox protein knotted-1-like 1 | ||||
STRING | XP_008444506.1 | 1e-80 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4584 | 32 | 46 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G08150.1 | 1e-50 | KNOTTED-like from Arabidopsis thaliana |