PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cla020078 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 165aa MW: 17881.1 Da PI: 5.3209 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 178.7 | 5.4e-56 | 26 | 120 | 1 | 95 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 vreqdr+lPian+srimkk+lPan+ki+kdak+tvqecvsefisfvtseasdkcq+ekrktingddllwa+atlGfe+y++plk yl++yre+++ Cla020078 26 VREQDRLLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEEYIDPLKSYLTRYRECDA 120 69******************************************************************************************876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.3E-52 | 23 | 133 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.12E-39 | 29 | 131 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.3E-28 | 32 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.2E-21 | 60 | 78 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 63 | 79 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.2E-21 | 79 | 97 | No hit | No description |
PRINTS | PR00615 | 7.2E-21 | 98 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MAEPPTSPAG GSHESGGEQS PNTGGVREQD RLLPIANISR IMKKALPANG KIAKDAKDTV 60 QECVSEFISF VTSEASDKCQ KEKRKTINGD DLLWAMATLG FEEYIDPLKS YLTRYRECDA 120 KGSSRGGDES AKRDPVGALP GQNSQQYMQP GALTYINTQV IISLL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 2e-45 | 25 | 117 | 1 | 93 | NF-YB |
4awl_B | 2e-45 | 25 | 117 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-45 | 25 | 117 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681896 | 5e-71 | LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016. | |||
GenBank | LN713264 | 5e-71 | LN713264.1 Cucumis melo genomic chromosome, chr_10. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022138911.1 | 1e-112 | nuclear transcription factor Y subunit B-1-like isoform X3 | ||||
Swissprot | Q8VYK4 | 2e-71 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A1S3BDN1 | 1e-104 | A0A1S3BDN1_CUCME; nuclear transcription factor Y subunit B-1-like isoform X3 | ||||
STRING | XP_004143607.1 | 1e-104 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2545 | 33 | 82 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 6e-74 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|