PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla019630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family MIKC_MADS
Protein Properties Length: 227aa    MW: 25519.7 Da    PI: 10.2643
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla019630genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.72.3e-312776150
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
               krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyey+
  Cla019630 27 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYA 76
               79***********************************************8 PP

2K-box1133e-37951914100
      K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                ss++s++ea+++ +qqe+akL+++i nLq+ +RhllGe+++sLs+k+L++Le +Lek++++iRs+Knell+++ie++qk+e el+++n+ +r+k++e
  Cla019630  95 SSTVSVSEANTQFYQQESAKLRAQIGNLQNLNRHLLGESISSLSVKDLKSLEIKLEKGISRIRSRKNELLFAEIEYMQKREIELHNNNQLIRAKIAE 191
                67888*****************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.5E-401978IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.2071979IPR002100Transcription factor, MADS-box
CDDcd002653.54E-412093No hitNo description
SuperFamilySSF554551.31E-322092IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-332141IPR002100Transcription factor, MADS-box
PROSITE patternPS0035002175IPR002100Transcription factor, MADS-box
PfamPF003191.7E-262875IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-334156IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-335677IPR002100Transcription factor, MADS-box
PfamPF014861.3E-26103189IPR002487Transcription factor, K-box
PROSITE profilePS5129714.829105195IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MSFDNEESTG AERRSSSRTG RGKIEIKRIE NTTNRQVTFC KRRNGLLKKA YELSVLCDAE  60
VALIVFSTRG RLYEYANNSV RATISRYKKA CSDPSSTVSV SEANTQFYQQ ESAKLRAQIG  120
NLQNLNRHLL GESISSLSVK DLKSLEIKLE KGISRIRSRK NELLFAEIEY MQKREIELHN  180
NNQLIRAKIA ETERSQQNTS ANNAIAGRGR GEQGSVAPNL ELISSST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-202087168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_B2e-202087168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_C2e-202087168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_D2e-202087168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
3kov_A2e-202087168Myocyte-specific enhancer factor 2A
3kov_B2e-202087168Myocyte-specific enhancer factor 2A
3kov_I2e-202087168Myocyte-specific enhancer factor 2A
3kov_J2e-202087168Myocyte-specific enhancer factor 2A
3p57_A2e-202087168Myocyte-specific enhancer factor 2A
3p57_B2e-202087168Myocyte-specific enhancer factor 2A
3p57_C2e-202087168Myocyte-specific enhancer factor 2A
3p57_D2e-202087168Myocyte-specific enhancer factor 2A
3p57_I2e-202087168Myocyte-specific enhancer factor 2A
3p57_J2e-202087168Myocyte-specific enhancer factor 2A
6c9l_A2e-202094275Myocyte-specific enhancer factor 2B
6c9l_B2e-202094275Myocyte-specific enhancer factor 2B
6c9l_C2e-202094275Myocyte-specific enhancer factor 2B
6c9l_D2e-202094275Myocyte-specific enhancer factor 2B
6c9l_E2e-202094275Myocyte-specific enhancer factor 2B
6c9l_F2e-202094275Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX978010.0X97801.1 C.sativus CUS1 mRNA for put. transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443694.11e-128PREDICTED: floral homeotic protein AGAMOUS-like
SwissprotQ408851e-106AG_PETHY; Floral homeotic protein AGAMOUS
SwissprotQ435851e-106AG_TOBAC; Floral homeotic protein AGAMOUS
TrEMBLA0A1S3B8P71e-127A0A1S3B8P7_CUCME; floral homeotic protein AGAMOUS-like
STRINGXP_008443688.11e-127(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68429102
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.11e-100MIKC_MADS family protein
Publications ? help Back to Top
  1. Immink RG, et al.
    Analysis of the petunia MADS-box transcription factor family.
    Mol. Genet. Genomics, 2003. 268(5): p. 598-606
    [PMID:12589434]
  2. Cheung AY,Zhan XY,Wang H,Wu HM
    Organ-specific and Agamous-regulated expression and glycosylation of a pollen tube growth-promoting protein.
    Proc. Natl. Acad. Sci. U.S.A., 1996. 93(9): p. 3853-8
    [PMID:8632979]