PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cla019202

Organism

Citrullus lanatus

Taxonomic ID

3654

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus

Family

TALE

Protein Properties

Length: 116aa MW: 13594.3 Da PI: 9.5573

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cla019202	genome	ICuGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	33	1.1e-10	78	112	21	55
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 + +yp+ +e+ eLA+++gLt +q+ +WF N+R ++ Cla019202 78 QWPYPTDTEKVELAESTGLTRKQINNWFINQRKRH 112 469*****************************985 PP
2	ELK	35.3	2.4e-12	32	53	1	22
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++Llr Y+g+++sLkqEFs Cla019202 32 ELKDRLLREYGGHISSLKQEFS 53 9********************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03789	4.2E-9	32	53	IPR005539	ELK domain
PROSITE profile	PS51213	10.72	32	52	IPR005539	ELK domain
SMART	SM01188	1.9E-6	32	53	IPR005539	ELK domain
PROSITE profile	PS50071	13.102	52	115	IPR001356	Homeobox domain
SuperFamily	SSF46689	1.03E-18	54	114	IPR009057	Homeodomain-like
SMART	SM00389	5.6E-8	54	116	IPR001356	Homeobox domain
CDD	cd00086	1.62E-13	56	115	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.9E-26	57	115	IPR009057	Homeodomain-like
Pfam	PF05920	1.3E-17	72	111	IPR008422	Homeobox KN domain
PROSITE pattern	PS00027	0	90	113	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 116 aa Download sequence Send to blast
MISDETAPKE NISAGEVELQ DSLVVPGNED RELKDRLLRE YGGHISSLKQ EFSKTKKKAN 60 LPREAKQILL HWWNSHSQWP YPTDTEKVEL AESTGLTRKQ INNWFINQRK RHWKSP

Functional Description ? help Back to Top
Source	Description
UniProt	May play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004138104.1	3e-51	PREDICTED: homeobox protein knotted-1-like 2 isoform X2
Swissprot	P46640	4e-38	KNAT2_ARATH; Homeobox protein knotted-1-like 2
TrEMBL	A0A0A0LU96	6e-50	A0A0A0LU96_CUCSA; Uncharacterized protein
STRING	XP_004155021.1	1e-50	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF620	34	125

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G70510.1	2e-40	KNOTTED-like from Arabidopsis thaliana 2

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Zhang XL,Yang ZP,Zhang J,Zhang LG Ectopic expression of BraYAB1-702, a member of YABBY gene family in Chinese cabbage, causes leaf curling, inhibition of development of shoot apical meristem and flowering stage delaying in Arabidopsis thaliana. Int J Mol Sci, 2013. 14(7): p. 14872-91 [PMID:23863694] Kuijt SJ, et al. Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors. Plant Physiol., 2014. 164(4): p. 1952-66 [PMID:24532604] Scofield S,Dewitte W,Murray JA STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1. Plant Signal Behav, 2018. [PMID:24776954] Lee JE,Lampugnani ER,Bacic A,Golz JF SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis. Plant J., 2014. 80(1): p. 122-35 [PMID:25060324] Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] Li Z, et al. Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis. J Integr Plant Biol, 2016. 58(12): p. 959-970 [PMID:27273574] Lozano-Sotomayor P, et al. Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana. Plant J., 2016. 88(3): p. 437-451 [PMID:27402171]