PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cla018275 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 76aa MW: 8400.19 Da PI: 10.9257 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 133.7 | 4.7e-42 | 11 | 76 | 5 | 70 |
S1FA 5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 ++a+G+nPGlivllvvgglll flvgny+ly+yaqk+lPP+kkkPvskkk+kre+lkqG+++PGe Cla018275 11 DADARGFNPGLIVLLVVGGLLLAFLVGNYALYMYAQKTLPPKKKKPVSKKKMKRERLKQGISAPGE 76 5789*************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD019013 | 0.007 | 9 | 76 | No hit | No description |
Pfam | PF04689 | 2.7E-41 | 12 | 76 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 76 aa Download sequence Send to blast |
MLMEKGNVIR DADARGFNPG LIVLLVVGGL LLAFLVGNYA LYMYAQKTLP PKKKKPVSKK 60 KMKRERLKQG ISAPGE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681842 | 9e-74 | LN681842.1 Cucumis melo genomic scaffold, anchoredscaffold00022. | |||
GenBank | LN713259 | 9e-74 | LN713259.1 Cucumis melo genomic chromosome, chr_5. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010104121.2 | 3e-28 | DNA-binding protein S1FA | ||||
Refseq | XP_024026346.1 | 3e-28 | DNA-binding protein S1FA | ||||
Swissprot | P42553 | 1e-16 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
TrEMBL | W9SCA3 | 4e-29 | W9SCA3_9ROSA; DNA-binding protein S1FA1 | ||||
STRING | XP_010104121.1 | 6e-30 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5409 | 33 | 55 |