PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cla016504

Organism

Citrullus lanatus

Taxonomic ID

3654

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus

Family

MYB

Protein Properties

Length: 208aa MW: 24074.3 Da PI: 6.5266

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cla016504	genome	ICuGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.8	5.2e-18	11	58	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd+ll ++vk +G g+W+++a+ g++Rt+k+c++rw +yl Cla016504 11 KGPWTCEEDKLLCEYVKVHGEGRWTSVANGSGLNRTGKSCRLRWVNYL 58 79********************************************97 PP
2	Myb_DNA-binding	51.6	2.1e-16	64	108	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg T++E+ +++++++++G++ W+tIar+++ gRt++++k++w+++ Cla016504 64 RGHLTPQEEGIIIELHALWGNK-WSTIARYLP-GRTDNEIKNYWRTH 108 6778****************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.303	1	58	IPR017930	Myb domain
SuperFamily	SSF46689	5.62E-31	9	105	IPR009057	Homeodomain-like
SMART	SM00717	1.4E-14	10	60	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-16	11	58	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.9E-22	12	65	IPR009057	Homeodomain-like
CDD	cd00167	3.58E-10	13	58	No hit	No description
PROSITE profile	PS51294	23.834	59	113	IPR017930	Myb domain
SMART	SM00717	7.9E-14	63	111	IPR001005	SANT/Myb domain
Pfam	PF00249	2.5E-14	64	108	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.1E-23	66	111	IPR009057	Homeodomain-like
CDD	cd00167	1.24E-9	68	109	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009737	Biological Process	response to abscisic acid
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 208 aa Download sequence Send to blast
MDGKEVQEWR KGPWTCEEDK LLCEYVKVHG EGRWTSVANG SGLNRTGKSC RLRWVNYLRP 60 GLKRGHLTPQ EEGIIIELHA LWGNKWSTIA RYLPGRTDNE IKNYWRTHFK KMKPKRKTQI 120 NVPKTATVNK TFPPITSSRE YGMELMKPYE RDDDSAMVFT EPAAMGDELS YLSMVYQDFA 180 TWAAEAAAEQ EEESLWGGLW EVPENDII

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-25	11	111	7	106	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.
UniProt	Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269\|PubMed:22301384}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00388	DAP	Transfer from AT3G30210	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269\|PubMed:22301384}.
UniProt	INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16531467}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681889	3e-48	LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBank	LN713263	3e-48	LN713263.1 Cucumis melo genomic chromosome, chr_9.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008459705.1	1e-107	PREDICTED: transcription factor MYB59-like
Swissprot	Q10MB4	2e-49	MYB2_ORYSJ; Transcription factor MYB2
Swissprot	Q4JL84	4e-50	MYB59_ARATH; Transcription factor MYB59
TrEMBL	A0A1S3CAT1	1e-106	A0A1S3CAT1_CUCME; transcription factor MYB59-like
STRING	XP_008459705.1	1e-107	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1182	34	108

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G30210.1	2e-67	myb domain protein 121

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Yang A,Dai X,Zhang WH A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice. J. Exp. Bot., 2012. 63(7): p. 2541-56 [PMID:22301384] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Chen X, et al. The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway. Plant Cell Physiol., 2014. 55(3): p. 604-19 [PMID:24399239] Lv Y, et al. New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis. Plant Cell Environ., 2016. 39(3): p. 556-70 [PMID:26381647] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774] Nishida S,Kakei Y,Shimada Y,Fujiwara T Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana. Plant J., 2017. 91(4): p. 741-753 [PMID:28586097] Hickman R, et al. Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network. Plant Cell, 2017. 29(9): p. 2086-2105 [PMID:28827376]