PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cla010331 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 96aa MW: 10332.5 Da PI: 8.2928 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 103.2 | 1.7e-32 | 27 | 82 | 3 | 59 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 +vrY eC+kNhAa +Gg+avDGC+Efm+s g+egt+aal+CaACgCHRnFHRr+v + Cla010331 27 SVRYGECQKNHAAGVGGYAVDGCREFMAS-GDEGTTAALTCAACGCHRNFHRRQVGT 82 79**************************9.999********************9865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 2.0E-24 | 1 | 93 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 2.8E-30 | 28 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 7.6E-27 | 29 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 25.889 | 30 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
MRKRQVVLRR SEEPSRETVA SSFTVRSVRY GECQKNHAAG VGGYAVDGCR EFMASGDEGT 60 TAALTCAACG CHRNFHRRQV GTEVVCDCSS SPSNGT |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681889 | 1e-110 | LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051. | |||
GenBank | LN713263 | 1e-110 | LN713263.1 Cucumis melo genomic chromosome, chr_9. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016902406.1 | 1e-63 | PREDICTED: mini zinc finger protein 2 | ||||
Swissprot | Q9LJW5 | 2e-43 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A1S4E2E9 | 3e-62 | A0A1S4E2E9_CUCME; mini zinc finger protein 2 | ||||
STRING | XP_008459312.1 | 4e-63 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1550 | 34 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 7e-35 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|