PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cla009725 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 229aa MW: 26399.9 Da PI: 10.1165 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.5 | 1.4e-31 | 17 | 66 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ Cla009725 17 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 66 79***********************************************8 PP | |||||||
2 | K-box | 114.9 | 7.8e-38 | 85 | 181 | 4 | 100 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 +++ s++ea+++ +qqe+akL+ +i nLq+++R++lGe+L+sLs+k+L++Le++Lek++++iRskKnell+++ie+++k+e +l+++n+ Lr+k++e Cla009725 85 TNTGSTSEANTQFYQQEAAKLRVQIGNLQNSNRNMLGESLSSLSVKDLRSLESKLEKGISRIRSKKNELLFAEIEYMRKREIDLHNNNQLLRAKIAE 181 3334499***************************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 34.132 | 9 | 69 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.1E-42 | 9 | 68 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 9.94E-34 | 10 | 86 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.24E-45 | 10 | 84 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 11 | 65 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.8E-33 | 11 | 31 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.2E-27 | 18 | 65 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.8E-33 | 31 | 46 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.8E-33 | 46 | 67 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.4E-28 | 92 | 179 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.348 | 95 | 185 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0048440 | Biological Process | carpel development | ||||
GO:0048443 | Biological Process | stamen development | ||||
GO:0048497 | Biological Process | maintenance of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 229 aa Download sequence Send to blast |
MSDSPQRKMG RGKIEIKRIE NTTNRQVTFC KRRNGLLKKA YELSVLCDAE VALIVFSSRG 60 RLYEYANNSV KATIDRYKKA SSDSTNTGST SEANTQFYQQ EAAKLRVQIG NLQNSNRNML 120 GESLSSLSVK DLRSLESKLE KGISRIRSKK NELLFAEIEY MRKREIDLHN NNQLLRAKIA 180 ESERNVNMMG GEFELMQSHP YDPRDFFQVN GLQHNHQYPR QDNMALQLV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-21 | 9 | 81 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-21 | 9 | 81 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-21 | 9 | 81 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-21 | 9 | 81 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_A | 2e-21 | 9 | 81 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-21 | 9 | 81 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-21 | 9 | 81 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-21 | 9 | 81 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-21 | 9 | 81 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-21 | 9 | 81 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00609 | ChIP-seq | Transfer from AT4G18960 | Download |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF022379 | 0.0 | AF022379.1 Cucumis sativus agamous-like putative transcription factor (CAG3) mRNA, complete cds. | |||
GenBank | AF035438 | 0.0 | AF035438.1 Cucumis sativus MADS box protein CUM1 (CUM1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022925702.1 | 1e-168 | floral homeotic protein AGAMOUS | ||||
Refseq | XP_023544246.1 | 1e-168 | floral homeotic protein AGAMOUS-like | ||||
Swissprot | Q43585 | 1e-127 | AG_TOBAC; Floral homeotic protein AGAMOUS | ||||
TrEMBL | O64958 | 1e-164 | O64958_CUCSA; CUM1 | ||||
TrEMBL | Q9SBK1 | 1e-165 | Q9SBK1_CUCSA; Agamous-like putative transcription factor | ||||
STRING | XP_008439700.1 | 1e-165 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF684 | 29 | 102 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18960.1 | 1e-115 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|