PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla006463
Organism
Citrullus lanatus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family M-type_MADS
Protein Properties Length: 106aa    MW: 11716.6 Da    PI: 10.1736
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla006463genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.57.1e-231761549
               SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
     SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
               n+sn qvtfskRr g++KKA+EL++LC+ae+a+i+fs+  k++ +
  Cla006463 17 NESNLQVTFSKRRSGLFKKASELCTLCGAEIAIIVFSPGKKVFSF 61
               99*************************************999887 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-30564IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.549565IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-26678IPR002100Transcription factor, MADS-box
CDDcd002656.49E-34673No hitNo description
PRINTSPR004042.8E-19727IPR002100Transcription factor, MADS-box
PfamPF003198.1E-251661IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-192742IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-194263IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009960Biological Processendosperm development
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MRKSRGRQKV EMVKMPNESN LQVTFSKRRS GLFKKASELC TLCGAEIAII VFSPGKKVFS  60
FGHPCVEALI ERFVTRNPPP SSGTLQLIEA HRNGTECTTY SSAEPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-17684179Myocyte-specific enhancer factor 2A
3kov_B2e-17684179Myocyte-specific enhancer factor 2A
3kov_I2e-17684179Myocyte-specific enhancer factor 2A
3kov_J2e-17684179Myocyte-specific enhancer factor 2A
3p57_A2e-17684179Myocyte-specific enhancer factor 2A
3p57_B2e-17684179Myocyte-specific enhancer factor 2A
3p57_C2e-17684179Myocyte-specific enhancer factor 2A
3p57_D2e-17684179Myocyte-specific enhancer factor 2A
3p57_I2e-17684179Myocyte-specific enhancer factor 2A
3p57_J2e-17684179Myocyte-specific enhancer factor 2A
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818741e-100LN681874.1 Cucumis melo genomic scaffold, anchoredscaffold00031.
GenBankLN7132611e-100LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004150272.13e-62PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK25e-44AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLA0A0A0KWA96e-61A0A0A0KWA9_CUCSA; Uncharacterized protein
STRINGXP_004156875.11e-61(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-46AGAMOUS-like 62
Publications ? help Back to Top
  1. Xu W, et al.
    Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds.
    Plant Cell, 2016. 28(6): p. 1343-60
    [PMID:27233529]
  2. Figueiredo DD,Batista RA,Roszak PJ,Köhler C
    Auxin production couples endosperm development to fertilization.
    Nat Plants, 2015. 1: p. 15184
    [PMID:27251719]
  3. Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C
    Auxin production in the endosperm drives seed coat development in Arabidopsis.
    Elife, 2017.
    [PMID:27848912]
  4. Fiume E,Coen O,Xu W,Lepiniec L,Magnani E
    Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal.
    Plant Signal Behav, 2017. 12(8): p. e1339000
    [PMID:28613109]
  5. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]