PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cla006222 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 174aa MW: 20645.7 Da PI: 10.175 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.3 | 6.5e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaevaviifs++g+lye++s Cla006222 9 KRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQKGRLYEFAS 59 79***********************************************86 PP | |||||||
2 | K-box | 48.2 | 4.5e-17 | 85 | 138 | 33 | 86 |
K-box 33 reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke 86 + q +llG +L+s+s+ eLq L qL++sl +iR++K +l++eqi++lq+k + Cla006222 85 QLQLQLLGYGLDSCSHDELQVLDAQLQRSLFQIRARKAQLYKEQIQQLQEKVIN 138 45679**********************************************876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.576 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.0E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.0E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 9.77E-44 | 3 | 78 | No hit | No description |
SuperFamily | SSF55455 | 3.79E-33 | 3 | 83 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.9E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.0E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.0E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 8.754 | 66 | 174 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 3.0E-13 | 87 | 136 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MVRGKVEMKR IENATSRQVT FSKRRNGLLK KAYELSVLCD AEVAVIIFSQ KGRLYEFASS 60 EMPRIVERYR KCSRDGKNST RFDRQLQLQL LGYGLDSCSH DELQVLDAQL QRSLFQIRAR 120 KAQLYKEQIQ QLQEKVINSV RNVFFFPSFY DNYYDTFFFQ FRKDSFQKKT GNCL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 7e-21 | 1 | 83 | 1 | 83 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 7e-21 | 1 | 83 | 1 | 83 | Myocyte-specific enhancer factor 2B |
1tqe_R | 7e-21 | 1 | 83 | 1 | 83 | Myocyte-specific enhancer factor 2B |
1tqe_S | 7e-21 | 1 | 83 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_A | 7e-21 | 1 | 83 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_B | 7e-21 | 1 | 83 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_C | 7e-21 | 1 | 83 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_D | 7e-21 | 1 | 83 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_E | 7e-21 | 1 | 83 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_F | 7e-21 | 1 | 83 | 1 | 83 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681848 | 4e-78 | LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006. | |||
GenBank | LN713260 | 4e-78 | LN713260.1 Cucumis melo genomic chromosome, chr_6. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008439149.1 | 1e-77 | PREDICTED: MADS-box protein AGL42-like isoform X2 | ||||
Swissprot | Q9FIS1 | 2e-55 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A1S3AXN7 | 3e-76 | A0A1S3AXN7_CUCME; MADS-box protein AGL42-like isoform X2 | ||||
STRING | XP_008439148.1 | 2e-76 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF666 | 30 | 102 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 6e-54 | AGAMOUS-like 42 |