PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cla004460 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 175aa MW: 18844.9 Da PI: 5.7344 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 177 | 1.8e-55 | 19 | 114 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 re+dr+lPianv+rimkk+lP+nakiskdaketvqecvsefisfvt+easdkc++ekrktingddllwa+atlGfedyv+plk++l+++re+ege+ Cla004460 19 REHDRLLPIANVGRIMKKALPGNAKISKDAKETVQECVSEFISFVTGEASDKCHNEKRKTINGDDLLWAMATLGFEDYVDPLKLHLQRFREIEGER 114 799*******************************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 6.2E-51 | 14 | 126 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 7.27E-39 | 22 | 123 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.3E-28 | 24 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.2E-20 | 52 | 70 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 55 | 71 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.2E-20 | 71 | 89 | No hit | No description |
PRINTS | PR00615 | 4.2E-20 | 90 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MADSDNDSGG GYQKSPSPRE HDRLLPIANV GRIMKKALPG NAKISKDAKE TVQECVSEFI 60 SFVTGEASDK CHNEKRKTIN GDDLLWAMAT LGFEDYVDPL KLHLQRFREI EGERTTLASR 120 DSASAANPAG ATNSTFFDGG GEFGGGMGMS MPPNVYGSNG PRWDGPGFTT TGRPR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 4e-47 | 17 | 109 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 4e-47 | 17 | 109 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681860 | 1e-150 | LN681860.1 Cucumis melo genomic scaffold, anchoredscaffold00021. | |||
GenBank | LN713260 | 1e-150 | LN713260.1 Cucumis melo genomic chromosome, chr_6. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004148262.1 | 7e-97 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 1e-65 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A0A0L4U4 | 2e-95 | A0A0A0L4U4_CUCSA; Uncharacterized protein | ||||
STRING | XP_004164637.1 | 3e-96 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF591 | 34 | 150 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 1e-67 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|