PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cla002356 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 165aa MW: 19336.4 Da PI: 10.2668 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.4 | 2.8e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtfskRrng+lKKA+ELSvLCdaev+viifs++g+lye+ss Cla002356 9 KRIENSTSRQVTFSKRRNGLLKKAYELSVLCDAEVSVIIFSQKGRLYEFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 46.1 | 2.1e-16 | 89 | 150 | 9 | 70 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 l++ +++l+qe++ k+ie+L+++q +llG +L+s+s++eL+ +e+qL +sl++iR++K Cla002356 89 LHQMSMQQLKQEADMTAKKIEQLEKSQEKLLGRGLDSCSFEELRGIERQLVHSLTRIRETKV 150 5677899*****************************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 6.4E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.562 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.96E-33 | 3 | 79 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.69E-43 | 3 | 78 | No hit | No description |
Pfam | PF00319 | 6.0E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 8.4E-15 | 91 | 150 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 9.552 | 94 | 165 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MVRGKVEMKR IENSTSRQVT FSKRRNGLLK KAYELSVLCD AEVSVIIFSQ KGRLYEFSSS 60 DMQKTIERYR SYGKDGQTNP FRSEGYMQLH QMSMQQLKQE ADMTAKKIEQ LEKSQEKLLG 120 RGLDSCSFEE LRGIERQLVH SLTRIRETKV RFKIPILLHF YVTSL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3mu6_A | 4e-21 | 3 | 72 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3mu6_B | 4e-21 | 3 | 72 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3mu6_C | 4e-21 | 3 | 72 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3mu6_D | 4e-21 | 3 | 72 | 2 | 71 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681895 | 3e-75 | LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005. | |||
GenBank | LN713263 | 3e-75 | LN713263.1 Cucumis melo genomic chromosome, chr_9. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008467251.1 | 2e-89 | PREDICTED: MADS-box protein AGL42-like | ||||
Refseq | XP_011654887.1 | 6e-89 | PREDICTED: MADS-box protein SOC1 isoform X2 | ||||
Refseq | XP_016903703.1 | 2e-89 | PREDICTED: MADS-box protein AGL42-like | ||||
Swissprot | Q9FIS1 | 4e-61 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A0A0KL39 | 1e-87 | A0A0A0KL39_CUCSA; Uncharacterized protein | ||||
TrEMBL | A0A1S4E646 | 6e-88 | A0A1S4E646_CUCME; MADS-box protein AGL42-like | ||||
STRING | XP_008467250.1 | 9e-89 | (Cucumis melo) | ||||
STRING | XP_004143644.1 | 5e-88 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF666 | 30 | 102 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 2e-63 | AGAMOUS-like 42 |