PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.27691s0001.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 208aa MW: 23940.8 Da PI: 9.9197 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 180.8 | 3.4e-56 | 21 | 147 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 lppGfrFhPtdeel+++yL++kv + ++ +i evd++kvePwdLp ++k +ekewyfF+ +d+ky+tg+r+nratk+gyWkatgkd Cagra.27691s0001.1.p 21 LPPGFRFHPTDEELITHYLRPKVLNPFFSS-LAIGEVDLNKVEPWDLPWMAKIGEKEWYFFCVKDRKYPTGSRTNRATKAGYWKATGKD 108 79**********************999888.67***************888899*********************************** PP NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 k++++ +++lvg+kktLvfykgrapkg+kt+Wvmheyrle Cagra.27691s0001.1.p 109 KAIFK-GKTLVGMKKTLVFYKGRAPKGVKTNWVMHEYRLE 147 ****9.999*****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.7E-62 | 18 | 171 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.316 | 21 | 171 | IPR003441 | NAC domain |
Pfam | PF02365 | 8.2E-31 | 22 | 146 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 208 aa Download sequence Send to blast |
MDYKVSRIRE IVEEDSDKID LPPGFRFHPT DEELITHYLR PKVLNPFFSS LAIGEVDLNK 60 VEPWDLPWMA KIGEKEWYFF CVKDRKYPTG SRTNRATKAG YWKATGKDKA IFKGKTLVGM 120 KKTLVFYKGR APKGVKTNWV MHEYRLEGEF AIDDLPKTAK NECVISRVFH KRADGTKMHI 180 SGLMFGSGVN KFEPVGLPPL MDSSLYLK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-51 | 18 | 177 | 14 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-51 | 18 | 177 | 14 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-51 | 18 | 177 | 14 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-51 | 18 | 177 | 14 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-51 | 18 | 177 | 17 | 174 | NAC domain-containing protein 19 |
3swm_B | 4e-51 | 18 | 177 | 17 | 174 | NAC domain-containing protein 19 |
3swm_C | 4e-51 | 18 | 177 | 17 | 174 | NAC domain-containing protein 19 |
3swm_D | 4e-51 | 18 | 177 | 17 | 174 | NAC domain-containing protein 19 |
3swp_A | 4e-51 | 18 | 177 | 17 | 174 | NAC domain-containing protein 19 |
3swp_B | 4e-51 | 18 | 177 | 17 | 174 | NAC domain-containing protein 19 |
3swp_C | 4e-51 | 18 | 177 | 17 | 174 | NAC domain-containing protein 19 |
3swp_D | 4e-51 | 18 | 177 | 17 | 174 | NAC domain-containing protein 19 |
4dul_A | 4e-51 | 18 | 177 | 14 | 171 | NAC domain-containing protein 19 |
4dul_B | 4e-51 | 18 | 177 | 14 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4-5n)[AG][CT]ACGCAA-3' (PubMed:16359384, PubMed:21303842). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:21303842). {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:21303842}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.27691s0001.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Rapidly and strongly induced by H(2)O(2) treatment in both leaves and roots. Accumulates during senescence and in response to wounding. {ECO:0000269|PubMed:21303842}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY062638 | 1e-170 | AY062638.1 Arabidopsis thaliana Unknown protein (MRI12.1) mRNA, complete cds. | |||
GenBank | BT008716 | 1e-170 | BT008716.1 Arabidopsis thaliana At3g29035 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006291582.1 | 1e-150 | NAC domain-containing protein 59 | ||||
Swissprot | Q9LJW3 | 1e-123 | NAC59_ARATH; NAC domain-containing protein 59 | ||||
TrEMBL | R0HH43 | 1e-149 | R0HH43_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.27691s0001.1.p | 1e-153 | (Capsella grandiflora) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM400 | 28 | 174 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G29035.1 | 1e-125 | NAC domain containing protein 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.27691s0001.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|