PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.24523s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family ARF
Protein Properties Length: 210aa    MW: 23214.2 Da    PI: 9.7467
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.24523s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B340.45.2e-1327715399
                          EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                    B3 53 rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                          r +++r++lt+GW++Fv+ ++L +gD+vvF+  ++s  e++++v+r+
  Cagra.24523s0002.1.p 27 RTTPRRHLLTTGWSKFVNNKKLIAGDSVVFM--RKSADEMFIGVRRA 71
                          667889*************************..44788899***997 PP

2Auxin_resp90.43.1e-30126208183
            Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrl.sGtvvgvsdldpvrWpnSkWrsLk 83 
                           a+++a+++ +FevvY+P a++s+Fvvk+e+ve+++ + +++G+R+kma+etedss++++ +G+v ++ + ++  W++S+W++L+
  Cagra.24523s0002.1.p 126 AINRAAQGLPFEVVYYPTAGWSDFVVKAEDVEASMAIFWTPGTRVKMAMETEDSSRITWfQGIVFSTYQ-ETGPWRGSPWKQLQ 208
                           67899******************************************************9******999.888*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.024172IPR003340B3 DNA binding domain
CDDcd100172.25E-72566No hitNo description
SuperFamilySSF1019362.35E-102672IPR015300DNA-binding pseudobarrel domain
PfamPF023624.9E-102771IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.7E-122772IPR015300DNA-binding pseudobarrel domain
PfamPF065075.1E-25126208IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MQRPHLWLIA SATSLHCCWH KGSSSSRTTP RRHLLTTGWS KFVNNKKLIA GDSVVFMRKS  60
ADEMFIGVRR APISSNVGGT SFYGGDEYCS YYQSSGGVAK EDDGSAKKGF RRTGKGKLTA  120
EAVSEAINRA AQGLPFEVVY YPTAGWSDFV VKAEDVEASM AIFWTPGTRV KMAMETEDSS  180
RITWFQGIVF STYQETGPWR GSPWKQLQV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.24523s0002.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0071430.0AC007143.5 Arabidopsis thaliana chromosome 2 BAC T17H1 genomic sequence, complete sequence.
GenBankAK2300140.0AK230014.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL22-53-A06.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankJF7292000.0JF729200.1 Arabidopsis thaliana ecotype C24 mitochondrion, complete genome.
GenBankJF7292010.0JF729201.1 Arabidopsis thaliana ecotype Col-0 mitochondrion, complete genome.
GenBankJF7292020.0JF729202.1 Arabidopsis thaliana ecotype Landsberg erecta mitochondrion, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302016.21e-109auxin response factor 17
SwissprotP925301e-105M940_ARATH; Uncharacterized mitochondrial protein AtMg00940
TrEMBLA0A178U5R51e-125A0A178U5R5_ARATH; Auxin response factor
STRINGCagra.24523s0002.1.p1e-155(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58027130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77850.11e-100auxin response factor 17
Publications ? help Back to Top
  1. Unseld M,Marienfeld JR,Brandt P,Brennicke A
    The mitochondrial genome of Arabidopsis thaliana contains 57 genes in 366,924 nucleotides.
    Nat. Genet., 1997. 15(1): p. 57-61
    [PMID:8988169]