PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.2337s0007.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 209aa MW: 23979.2 Da PI: 10.3986 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.5 | 1e-15 | 20 | 67 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEde+l v ++G g+W+tI+ g+ R +k+c++rw +yl Cagra.2337s0007.1.p 20 KGLWSPEEDEKLRSHVLKYGHGCWSTIPILTGLQRNGKSCRLRWVNYL 67 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 49.5 | 9.6e-16 | 75 | 117 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +T+eE+ lv ++ +lG++ W+ I++ ++ gRt++++k++w++ Cagra.2337s0007.1.p 75 TFTKEEETTLVSLHSMLGNK-WSQISKFLP-GRTDNEIKNYWHSN 117 79******************.*********.***********975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.0E-22 | 14 | 70 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.489 | 15 | 67 | IPR017930 | Myb domain |
SMART | SM00717 | 2.5E-11 | 19 | 69 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.73E-30 | 19 | 114 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.5E-13 | 20 | 67 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.23E-10 | 23 | 67 | No hit | No description |
PROSITE profile | PS51294 | 24.491 | 68 | 122 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-23 | 71 | 121 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.8E-15 | 72 | 120 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.2E-14 | 74 | 117 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.30E-10 | 75 | 118 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 209 aa Download sequence Send to blast |
MVYKSEKPNR KMKSKEKQRK GLWSPEEDEK LRSHVLKYGH GCWSTIPILT GLQRNGKSCR 60 LRWVNYLRPG LKKCTFTKEE ETTLVSLHSM LGNKWSQISK FLPGRTDNEI KNYWHSNLKK 120 GVSLTKHVTT RTPQTSSVKS SLEALQSTTE RSSSSISVGE TFNAQTPSFL PSLVFSEWLD 180 YSLFTDQSPQ KTSYVQNSVV PEERRFTGP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-27 | 20 | 122 | 27 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.2337s0007.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519596 | 0.0 | AY519596.1 Arabidopsis thaliana MYB transcription factor (At3g48920) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006292379.1 | 1e-149 | transcription factor LAF1 | ||||
Swissprot | Q9M0K4 | 2e-58 | LAF1_ARATH; Transcription factor LAF1 | ||||
TrEMBL | R0FRN7 | 1e-147 | R0FRN7_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.2337s0007.1.p | 1e-152 | (Capsella grandiflora) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G48920.1 | 1e-111 | myb domain protein 45 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.2337s0007.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|