PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cagra.10348s0001.1.p

Organism

Capsella grandiflora

Taxonomic ID

264402

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella

Family

MYB_related

Protein Properties

Length: 161aa MW: 18288.3 Da PI: 6.5138

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cagra.10348s0001.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	46.6	7.8e-15	5	48	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg + eE+ ++++++ ++G++ W++Ia+ ++ gRt++++k++w++ Cagra.10348s0001.1.p 5 RGDISLEEQFIILELHSRWGNR-WSKIAQQLP-GRTDNEIKNYWRT 48 567789**************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.6E-19	1	52	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.48E-12	1	58	IPR009057	Homeodomain-like
PROSITE profile	PS51294	23.064	1	54	IPR017930	Myb domain
SMART	SM00717	1.3E-12	4	52	IPR001005	SANT/Myb domain
Pfam	PF00249	1.7E-13	5	48	IPR001005	SANT/Myb domain
CDD	cd00167	1.07E-9	9	48	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009651	Biological Process	response to salt stress
GO:0009737	Biological Process	response to abscisic acid
GO:0009751	Biological Process	response to salicylic acid
GO:0046686	Biological Process	response to cadmium ion
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 161 aa Download sequence Send to blast
PDIRRGDISL EEQFIILELH SRWGNRWSKI AQQLPGRTDN EIKNYWRTRV QKHAKLLKCD 60 VNSKQFKDLI KHYWMPRLVE RIATAQVVES VPNHHSSEAT AGAASSTSSS ESSVRSSFYG 120 GDQVEYGTLD HMTNGGDWFN GGDALETLWS VDELNNWLLQ *

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269\|PubMed:22301384}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Cagra.10348s0001.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269\|PubMed:22301384}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK229083	1e-129	AK229083.1 Arabidopsis thaliana mRNA for putative transcription factor MYB112, complete cds, clone: RAFL16-36-L19.
GenBank	AY519562	1e-129	AY519562.1 Arabidopsis thaliana MYB transcription factor (At1g48000) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023645751.1	1e-115	transcription factor MYB108 isoform X2
Swissprot	Q10MB4	2e-45	MYB2_ORYSJ; Transcription factor MYB2
TrEMBL	R0I7Z8	1e-112	R0I7Z8_9BRAS; Uncharacterized protein
STRING	Cagra.10348s0001.1.p	1e-116	(Capsella grandiflora)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G48000.1	8e-82	myb domain protein 112

Link Out ? help Back to Top
Phytozome	Cagra.10348s0001.1.p

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yang A,Dai X,Zhang WH A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice. J. Exp. Bot., 2012. 63(7): p. 2541-56 [PMID:22301384] Chen X, et al. The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway. Plant Cell Physiol., 2014. 55(3): p. 604-19 [PMID:24399239] Lv Y, et al. New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis. Plant Cell Environ., 2016. 39(3): p. 556-70 [PMID:26381647] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774]