PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.0926s0015.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 120aa MW: 14215.5 Da PI: 7.4653 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 79.8 | 4.3e-25 | 6 | 97 | 4 | 95 |
DUF260 4 aCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 Ck r +C ++Cv+apy+pa+++ k+ + k++ ++++ +++ +++++er++ ++s ++eAear+rdPv G++g i+ lq qle+ k ++ Cagra.0926s0015.1.p 6 TCKEVRHNCIEECVFAPYLPATNKDKYTKLSKVYDMRRLAQYVMDIEPSERQICVDSFCFEAEARLRDPVFGVTGYIHLLQLQLEEIKPLIQ 97 7***********************************************************************************99886555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 16.36 | 2 | 103 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.0E-23 | 6 | 97 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 120 aa Download sequence Send to blast |
MEYSCTCKEV RHNCIEECVF APYLPATNKD KYTKLSKVYD MRRLAQYVMD IEPSERQICV 60 DSFCFEAEAR LRDPVFGVTG YIHLLQLQLE EIKPLIQIAK RDHMMILQRN RQNHRHDHL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 9e-18 | 6 | 93 | 14 | 101 | LOB family transfactor Ramosa2.1 |
5ly0_B | 9e-18 | 6 | 93 | 14 | 101 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.0926s0015.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019101899.1 | 9e-36 | PREDICTED: LOB domain-containing protein 6-like | ||||
TrEMBL | R0FR77 | 2e-80 | R0FR77_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.0926s0015.1.p | 8e-85 | (Capsella grandiflora) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G23660.2 | 2e-22 | LOB domain-containing protein 10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.0926s0015.1.p |