PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.0612s0059.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 176aa MW: 19140.3 Da PI: 5.3587 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 183.5 | 1.7e-57 | 26 | 123 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 vreqdrflPian+srimk+ lP n+ki+kdaket+qecvsefisfvtseasdkcqrekrktingddllwa+atlGfe+y+eplkvyl++y Cagra.0612s0059.1.p 26 VREQDRFLPIANISRIMKRGLPLNGKIAKDAKETMQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEEYIEPLKVYLMRY 115 69**************************************************************************************** PP NF-YB 91 relegekk 98 re+eg++k Cagra.0612s0059.1.p 116 REMEGDTK 123 *****975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.5E-54 | 24 | 141 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.48E-40 | 29 | 134 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.5E-27 | 32 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.8E-21 | 60 | 78 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 63 | 79 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.8E-21 | 79 | 97 | No hit | No description |
PRINTS | PR00615 | 2.8E-21 | 98 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MAESQTGGGG GSHESGGDQS PRSLNVREQD RFLPIANISR IMKRGLPLNG KIAKDAKETM 60 QECVSEFISF VTSEASDKCQ REKRKTINGD DLLWAMATLG FEEYIEPLKV YLMRYREMEG 120 DTKGSGKGGE SSGKRDGQPS QVSQFSQLPQ QGSFSQGPYG NSQASNMMVQ MPGTE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 7e-47 | 26 | 117 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 7e-47 | 26 | 117 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.0612s0059.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK176827 | 0.0 | AK176827.1 Arabidopsis thaliana mRNA for transcription factor NF-Y, CCAAT-binding - like protein, complete cds, clone: RAFL25-38-H16. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023638284.1 | 1e-127 | nuclear transcription factor Y subunit B-10 | ||||
Refseq | XP_023638285.1 | 1e-127 | nuclear transcription factor Y subunit B-10 | ||||
Swissprot | Q67XJ2 | 1e-113 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
TrEMBL | A0A178VNV1 | 1e-111 | A0A178VNV1_ARATH; NF-YB10 | ||||
TrEMBL | D7LUH2 | 1e-111 | D7LUH2_ARALL; Uncharacterized protein | ||||
STRING | Cagra.0612s0059.1.p | 1e-126 | (Capsella grandiflora) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1480 | 27 | 94 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 1e-100 | nuclear factor Y, subunit B10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.0612s0059.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|