PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0570s0036.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NZZ/SPL
Protein Properties Length: 336aa    MW: 36301.6 Da    PI: 8.4628
Description NZZ/SPL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0570s0036.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NOZZLE542.11.3e-16513351314
               NOZZLE   1 matslffmstdqnsvrnpnellrntrlvvnssgeirtetkksrgrkpgsktaqqkqkkptlrgmgvaklerfiieee..kkklvvatvgd 88 
                          matslffm tdqnsv+npnellrnt+l vnssgeirte++k rgrkpgsk +qq+qkkptlrgmgvakler +++ e   +k v+at gd
  Cagra.0570s0036.1.p   1 MATSLFFMPTDQNSVGNPNELLRNTHLGVNSSGEIRTEPQKCRGRKPGSKKGQQNQKKPTLRGMGVAKLERERLKTEaaENKQVAATLGD 90 
                          9********************************************************************998876652156779****** PP

               NOZZLE  89 tssvaaisntatr.lpvpvdrgvvlqgfpsslgs....srilcggvgsgqvmidpvispwgfvetsatthelssisnpqmynassnnrcd 173
                          t      +n+atr lpvpvd+ +vlqgfpss+g+    +ri+cggvgsgq+midpv+spwgfvet++ thelssi+npqm+nassn rcd
  Cagra.0570s0036.1.p  91 TLVAPPNPNNATRlLPVPVDPVLVLQGFPSSVGGgcrsNRIYCGGVGSGQIMIDPVCSPWGFVETTS-THELSSIPNPQMFNASSNTRCD 179
                          **88899******55*****************999999****************************9.9********************* PP

               NOZZLE 174 tcfkkkrldgdqnnvvrsngggfskytmipppmngydeyllqsdhhqrsqgflydq.riaraasvsa.asasinpyfneatnltgsreef 261
                          tcfkkkrld dqnnvvrsngggfskytmi ppmngy++ l+++d+++ sqgf+yd+ r+ar+a  sa a++sinpy+neatn+t s+eef
  Cagra.0570s0036.1.p 180 TCFKKKRLDEDQNNVVRSNGGGFSKYTMIQPPMNGYEH-LFHQDYQRSSQGFIYDHhRMARSAPPSAaAATSINPYLNEATNHTVSMEEF 268
                          ************************************99.99***88889*****9549*****876516789****************** PP

               NOZZLE 262 gs.vlegnprngsrgvkeyeffpgkydervsk......vakvaslvgdcspn.......tidlslkl 314
                          gs ++egnprngs+gvkeyeffpgkyd++ +       ++ ++ +vgdcsp        tidlslkl
  Cagra.0570s0036.1.p 269 GSgYMEGNPRNGSGGVKEYEFFPGKYDDFPGNygktvsSMATSVVVGDCSPTntsssssTIDLSLKL 335
                          *989************************976411122245567789*****88999999******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF087445.9E-1603335IPR014855Plant transcription factor NOZZLE
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MATSLFFMPT DQNSVGNPNE LLRNTHLGVN SSGEIRTEPQ KCRGRKPGSK KGQQNQKKPT  60
LRGMGVAKLE RERLKTEAAE NKQVAATLGD TLVAPPNPNN ATRLLPVPVD PVLVLQGFPS  120
SVGGGCRSNR IYCGGVGSGQ IMIDPVCSPW GFVETTSTHE LSSIPNPQMF NASSNTRCDT  180
CFKKKRLDED QNNVVRSNGG GFSKYTMIQP PMNGYEHLFH QDYQRSSQGF IYDHHRMARS  240
APPSAAAATS INPYLNEATN HTVSMEEFGS GYMEGNPRNG SGGVKEYEFF PGKYDDFPGN  300
YGKTVSSMAT SVVVGDCSPT NTSSSSSTID LSLKL*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator of sporocyte development (PubMed:10465788). Acts as an adapter-like transcriptional repressor recruiting TPL/TPR corepressors to inhibit TCP transcription factors (PubMed:25378179). Required for nucellus and embryo sac development (PubMed:10500234). Plays a central role in patterning both the proximal-distal and the adaxial-abaxial axes during ovule development (PubMed:12183381). Involved in establishing the prospective chalaza of the ovule and in controlling the cell number and the length of the funiculus, and is required for the development of the integuments (PubMed:10976054). Required, with BEL1, for cytokinin-induced PIN1 expression in ovules (PubMed:22786869). Involved in controlling stamen identity (PubMed:19726570). May also regulate the morphology of lateral organs by repressing auxin production (PubMed:18557819). {ECO:0000269|PubMed:10465788, ECO:0000269|PubMed:10500234, ECO:0000269|PubMed:10976054, ECO:0000269|PubMed:12183381, ECO:0000269|PubMed:18557819, ECO:0000269|PubMed:19726570, ECO:0000269|PubMed:22786869, ECO:0000269|PubMed:25378179}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.0570s0036.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by the transcription factor AGAMOUS (PubMed:15254538). Regulated by ATXR3/SDG2 via chromatin methylation (PubMed:21037105). Triggered by TGA9 AND TGA10 in anthers (PubMed:20805327). {ECO:0000269|PubMed:15254538, ECO:0000269|PubMed:20805327, ECO:0000269|PubMed:21037105}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285000.10.0protein SPOROCYTELESS
SwissprotO818361e-158SPL_ARATH; Protein SPOROCYTELESS
TrEMBLR0H3200.0R0H320_9BRAS; Uncharacterized protein
STRINGCagra.0570s0036.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134351828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27330.11e-147sporocyteless (SPL)
Publications ? help Back to Top
  1. Armenta-Medina A,Huanca-Mamani W,Sanchez-León N,Rodríguez-Arévalo I,Vielle-Calzada JP
    Functional analysis of sporophytic transcripts repressed by the female gametophyte in the ovule of Arabidopsis thaliana.
    PLoS ONE, 2013. 8(10): p. e76977
    [PMID:24194852]
  2. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]
  3. Zhao L, et al.
    Comparative expression profiling reveals gene functions in female meiosis and gametophyte development in Arabidopsis.
    Plant J., 2014. 80(4): p. 615-28
    [PMID:25182975]
  4. Yuan L,Sundaresan V
    Spore formation in plants: sporocyteless and more.
    Cell Res., 2015. 25(1): p. 7-8
    [PMID:25512340]
  5. Picó S,Ortiz-Marchena MI,Merini W,Calonje M
    Deciphering the Role of POLYCOMB REPRESSIVE COMPLEX1 Variants in Regulating the Acquisition of Flowering Competence in Arabidopsis.
    Plant Physiol., 2015. 168(4): p. 1286-97
    [PMID:25897002]
  6. Mao Y, et al.
    Development of germ-line-specific CRISPR-Cas9 systems to improve the production of heritable gene modifications in Arabidopsis.
    Plant Biotechnol. J., 2016. 14(2): p. 519-32
    [PMID:26360626]
  7. Rojas-Gracia P, et al.
    The parthenocarpic hydra mutant reveals a new function for a SPOROCYTELESS-like gene in the control of fruit set in tomato.
    New Phytol., 2017. 214(3): p. 1198-1212
    [PMID:28134991]
  8. Zhao F, et al.
    Phosphorylation of SPOROCYTELESS/NOZZLE by the MPK3/6 Kinase Is Required for Anther Development.
    Plant Physiol., 2017. 173(4): p. 2265-2277
    [PMID:28209842]
  9. Bi H,Fan W,Zhang P
    C4 Protein of Sweet Potato Leaf Curl Virus Regulates Brassinosteroid Signaling Pathway through Interaction with AtBIN2 and Affects Male Fertility in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1689
    [PMID:29021807]