PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.0551s0036.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 153aa MW: 17483.3 Da PI: 6.9119 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 168.4 | 8.8e-53 | 42 | 137 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa+a+lGf+dy+ l+ yl++yr Cagra.0551s0036.1.p 42 KEQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTLNGDDICWAMANLGFDDYAGHLTNYLHRYR 131 89**************************************************************************************** PP NF-YB 92 elegek 97 +ege+ Cagra.0551s0036.1.p 132 VTEGER 137 ***997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.0E-51 | 35 | 146 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.19E-39 | 44 | 145 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.1E-28 | 47 | 111 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.5E-15 | 75 | 93 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 78 | 94 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 3.5E-15 | 94 | 112 | No hit | No description |
PRINTS | PR00615 | 3.5E-15 | 113 | 131 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MAGDNPWFQN PTPRYQNYNF GSSSSRDHHG VDDDRQEEEN IKEQDRLLPI ANVGRIMKNI 60 LPPNAKISKE AKETMQECVS EFISFVTGEA SDKCHKEKRK TLNGDDICWA MANLGFDDYA 120 GHLTNYLHRY RVTEGERANH HHHHHQGKGA RP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 5e-43 | 41 | 131 | 1 | 91 | Transcription factor HapC (Eurofung) |
4g92_B | 5e-43 | 41 | 131 | 1 | 91 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.0551s0036.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006296212.1 | 1e-105 | nuclear transcription factor Y subunit B-5 | ||||
Swissprot | O82248 | 8e-80 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | R0HUM7 | 1e-104 | R0HUM7_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.0551s0036.1.p | 1e-113 | (Capsella grandiflora) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 2e-80 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.0551s0036.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|