PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.0342s0017.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 301aa MW: 32633.5 Da PI: 9.2266 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.9 | 5.3e-19 | 6 | 51 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde+l ++v ++G+++W+ I++ ++ gR++k+c++rw + Cagra.0342s0017.1.p 6 KGPWSPEEDEQLRRLVVKYGPRNWTVISKSIP-GRSGKSCRLRWCNQ 51 79******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 56.5 | 6.6e-18 | 60 | 102 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++eEde +++a++q+G++ W+tIar ++ gRt++ +k++w++ Cagra.0342s0017.1.p 60 PFSAEEDETIARAHAQFGNK-WATIARLLN-GRTDNAVKNHWNST 102 89******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 29.606 | 1 | 56 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.88E-31 | 3 | 99 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.6E-17 | 5 | 54 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.6E-19 | 6 | 51 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.7E-25 | 7 | 58 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.16E-17 | 8 | 50 | No hit | No description |
SMART | SM00717 | 1.3E-14 | 57 | 105 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.77 | 58 | 107 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.0E-22 | 59 | 106 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.26E-12 | 60 | 103 | No hit | No description |
Pfam | PF00249 | 6.8E-15 | 60 | 102 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0042742 | Biological Process | defense response to bacterium | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:2000022 | Biological Process | regulation of jasmonic acid mediated signaling pathway | ||||
GO:2000031 | Biological Process | regulation of salicylic acid mediated signaling pathway | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 301 aa Download sequence Send to blast |
MADRIKGPWS PEEDEQLRRL VVKYGPRNWT VISKSIPGRS GKSCRLRWCN QLSPQVEHRP 60 FSAEEDETIA RAHAQFGNKW ATIARLLNGR TDNAVKNHWN STLKRKCDHR GFDGSEDHRP 120 VKRSVSAGSP PVVSGPYMSP GSPTGSDVSD SSTIPILPAV ELFKPVPRPG AVVLPLPIET 180 TSSSDGPPTS LSLSLPGSDV SEESNRSHES TNSNTSSRHN KNNTLSFLPF SGGFRGAIED 240 MGRSFPGNGG EFMAVVQEMI KAEVRSYMAE MQRNNGSGFV GGFSNNGMIP MSQIGVGRIE 300 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-39 | 3 | 108 | 4 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202, ECO:0000269|PubMed:23603962, ECO:0000269|PubMed:24894996, ECO:0000269|PubMed:9678577}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00596 | DAP | Transfer from AT5G67300 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.0342s0017.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB007645 | 0.0 | AB007645.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K8K14. | |||
GenBank | AF326877 | 0.0 | AF326877.1 Arabidopsis thaliana putative myb-related protein, 33.3K (At5g67300) mRNA, complete cds. | |||
GenBank | AF339698 | 0.0 | AF339698.1 Arabidopsis thaliana putative myb-related protein, 33.3K (At5g67300) mRNA, complete cds. | |||
GenBank | AY519648 | 0.0 | AY519648.1 Arabidopsis thaliana MYB transcription factor (At5g67300) mRNA, complete cds. | |||
GenBank | CP002688 | 0.0 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006279745.1 | 0.0 | transcription factor MYB44 | ||||
Swissprot | Q9FDW1 | 0.0 | MYB44_ARATH; Transcription factor MYB44 | ||||
TrEMBL | R0GN94 | 0.0 | R0GN94_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.0342s0017.1.p | 0.0 | (Capsella grandiflora) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM677 | 28 | 135 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G67300.1 | 1e-175 | myb domain protein r1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.0342s0017.1.p |