PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cc11_g15430 | ||||||||
Common Name | GSCOC_T00038054001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 183aa MW: 21029.6 Da PI: 7.8005 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 30.3 | 7.3e-10 | 125 | 159 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 k +yp+++++ LA+++gL+++q+ +WF N+R ++ Cc11_g15430 125 KWPYPTEADKISLAESTGLDQKQINNWFINQRKRH 159 679*****************************885 PP | |||||||
2 | ELK | 32.1 | 2.6e-11 | 79 | 100 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK+ LlrKY+ +++sLk EFs Cc11_g15430 79 ELKETLLRKYGNHISSLKLEFS 100 9********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51213 | 10.144 | 79 | 99 | IPR005539 | ELK domain |
Pfam | PF03789 | 1.5E-7 | 79 | 100 | IPR005539 | ELK domain |
SMART | SM01188 | 5.6E-6 | 79 | 100 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.876 | 99 | 162 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.97E-20 | 100 | 173 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 6.9E-14 | 101 | 166 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 4.8E-29 | 104 | 163 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 4.84E-13 | 111 | 163 | No hit | No description |
Pfam | PF05920 | 3.8E-18 | 119 | 158 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 137 | 160 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MRSVGLWPFT FLSKPSKTHK KHAHTHLAVR TESESERERE GDVDCGLRSG DDGAVSSDDE 60 LSGVETDVQD SQTKAEDREL KETLLRKYGN HISSLKLEFS KKKKKGKLPK EARQILLEWW 120 NVHYKWPYPT EADKISLAES TGLDQKQINN WFINQRKRHW KPSENMQLAV MDSLSGQFFA 180 DD* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027100190.1 | 1e-91 | homeobox protein knotted-1-like 6 | ||||
Refseq | XP_027150726.1 | 2e-91 | homeobox protein knotted-1-like 6 | ||||
Swissprot | Q84JS6 | 7e-60 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A068UY52 | 1e-132 | A0A068UY52_COFCA; Uncharacterized protein | ||||
STRING | EOY00544 | 3e-68 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA753 | 24 | 80 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 2e-52 | KNOTTED1-like homeobox gene 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|