PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cc10_g06400 | ||||||||
Common Name | GSCOC_T00034664001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 106aa MW: 12240.9 Da PI: 9.1261 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 99.9 | 1.6e-31 | 21 | 79 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk++++pr+YY+C+++gC+vkk+ver+ edp+++++tYeg+Hnhe Cc10_g06400 21 LDDGFKWRKYGKKTVKSNPNPRNYYKCSTEGCKVKKRVERDGEDPSYLITTYEGRHNHE 79 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.3E-32 | 10 | 81 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 5.36E-28 | 14 | 81 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.364 | 16 | 81 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.6E-34 | 21 | 80 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.5E-25 | 22 | 79 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 106 aa Download sequence Send to blast |
MAKVDQGNII AIRTKTQLEI LDDGFKWRKY GKKTVKSNPN PRNYYKCSTE GCKVKKRVER 60 DGEDPSYLIT TYEGRHNHES PCFIYCDELP LAISYGWTLR PSQYS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-28 | 11 | 82 | 7 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 4e-28 | 11 | 82 | 7 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027089966.1 | 3e-74 | probable WRKY transcription factor 51 | ||||
Swissprot | Q93WU9 | 2e-38 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
TrEMBL | A0A068TY02 | 2e-73 | A0A068TY02_COFCA; Uncharacterized protein | ||||
STRING | XP_010261070.1 | 1e-47 | (Nelumbo nucifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2124 | 24 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64810.1 | 1e-40 | WRKY DNA-binding protein 51 |
Publications ? help Back to Top | |||
---|---|---|---|
|