PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cc08_g04480 | ||||||||
Common Name | GSCOC_T00015634001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 110aa MW: 12670.9 Da PI: 11.1583 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.1 | 1.3e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+ Ed l+ ++k +G g W++ +++ g++R++k+c++rw++yl Cc08_g04480 14 RGAWTPLEDRMLIGYIKSHGEGKWRSLPKRAGLKRCGKSCRLRWLNYL 61 89*********************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 7.8E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.396 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 1.0E-11 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.9E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 5.01E-22 | 15 | 89 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.93E-9 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 8.4E-8 | 65 | 88 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
MGRSPCCAKE GLNRGAWTPL EDRMLIGYIK SHGEGKWRSL PKRAGLKRCG KSCRLRWLNY 60 LRPDIKRGNI TADEEDLIIR LHKLLGNRRV TLTHHSFLIS LTNFLRQLF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-14 | 12 | 88 | 25 | 100 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. | |||||
UniProt | Transcription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027084319.1 | 2e-58 | myb-related protein Zm38-like | ||||
Swissprot | P10290 | 2e-44 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
Swissprot | P20024 | 3e-44 | MYB1_MAIZE; Myb-related protein Zm1 | ||||
TrEMBL | A0A068V4K1 | 7e-74 | A0A068V4K1_COFCA; Uncharacterized protein | ||||
STRING | XP_009602508.1 | 1e-53 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G16720.1 | 2e-45 | myb domain protein 7 |