PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cc08_g03330 | ||||||||
Common Name | GSCOC_T00010784001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 130aa MW: 15070.3 Da PI: 9.6233 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 51.6 | 1.9e-16 | 92 | 129 | 2 | 39 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrry 39 ke+al+ prC+stn+kfCyy ny+lsqPr fCk+ rry Cc08_g03330 92 KEQALNYPRCNSTNAKFCYYINYNLSQPRQFCKTYRRY 129 78999********************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 3.0E-12 | 84 | 129 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 1.6E-11 | 94 | 129 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 16.283 | 96 | 129 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
MIVADVSGNS SQCVFVCDFE VIENSRNNAQ LRNWPFRAYP IFVRVFISCK YSMSKFIGLK 60 VVKPMEEIVV PNDNTTSCTK SGSLERKVRS QKEQALNYPR CNSTNAKFCY YINYNLSQPR 120 QFCKTYRRY* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027181554.1 | 2e-30 | dof zinc finger protein DOF4.6 isoform X1 | ||||
Swissprot | Q84JQ8 | 1e-17 | DOF18_ARATH; Dof zinc finger protein DOF1.8 | ||||
TrEMBL | A0A068VD98 | 4e-90 | A0A068VD98_COFCA; Uncharacterized protein | ||||
STRING | POPTR_0001s11130.1 | 5e-23 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA88 | 24 | 419 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G64620.1 | 4e-20 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|