PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cc05_g11850 | ||||||||
Common Name | GSCOC_T00021262001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 159aa MW: 17498.6 Da PI: 10.2843 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 131.2 | 3.5e-41 | 38 | 112 | 2 | 76 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 C++e+C+adl++ k+yh+rhkvCe h+ka+vv+v+gl+qrfCqqCsrfh+lsefDe+krsCrrrLa+hnerrrk+ Cc05_g11850 38 CRAENCKADLTDSKSYHKRHKVCEYHAKAEVVVVEGLKQRFCQQCSRFHDLSEFDEAKRSCRRRLAGHNERRRKH 112 9************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 3.6E-34 | 34 | 99 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.872 | 35 | 112 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 4.41E-38 | 36 | 115 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.6E-31 | 38 | 111 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MNFDEGPRKR GSRTAAAAAE GAGGGGGGGV AVAPPPGCRA ENCKADLTDS KSYHKRHKVC 60 EYHAKAEVVV VEGLKQRFCQ QCSRFHDLSE FDEAKRSCRR RLAGHNERRR KHFTESRGEG 120 SGRRGSNPGT KKDQCRQVDE RGRTPIVLPE NHQKLHIH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-35 | 23 | 111 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027170735.1 | 1e-111 | squamosa promoter-binding-like protein 3 isoform X2 | ||||
Swissprot | Q9S7A9 | 3e-41 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
TrEMBL | A0A068UCK7 | 1e-111 | A0A068UCK7_COFCA; Uncharacterized protein | ||||
STRING | XP_010260271.1 | 6e-53 | (Nelumbo nucifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 3e-37 | squamosa promoter binding protein-like 3 |