PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc05_g10550
Common NameGSCOC_T00021428001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family STAT
Protein Properties Length: 722aa    MW: 80897.1 Da    PI: 5.9715
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc05_g10550genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT185.37.7e-582323511121
         STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkkypfl 98 
                  ldv+ll+a+ qp++k++evvasLlyad+ ++v +++d eapLL+sydG+e++s+drp+kl+ Grasfklk+sqLsskcdnrLfri+feipk+ +ypfl
  Cc05_g10550 232 LDVTLLDAFDQPLNKEMEVVASLLYADNNEPVPETNDGEAPLLTSYDGIEYASSDRPSKLISGRASFKLKMSQLSSKCDNRLFRIRFEIPKI-RYPFL 328
                  89*****************************************************************************************9.6**** PP

         STAT  99 eavskpirCisrsrntrsssltk 121
                  ea+s pirCisrsrn+r+ss t 
  Cc05_g10550 329 EAFSPPIRCISRSRNARASSITL 351
                  *****************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.505.109.3E-7618686IPR000980SH2 domain
SuperFamilySSF555503.23E-8621703IPR000980SH2 domain
PROSITE profilePS5000110.197625705IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
MVKILDGANV LEEMNYGLLK DLRVELKDSD TEENGAFCFS FWLYLANYGS PLPCGILHQE  60
HIDINSSVPF LLLNEKKKMM LLPVIFLHKE ASMLVGLNPL TEVPSIVTQF DIPLKKWVHV  120
GCEASQNSLR LRVNGEIVGE KHLTPVLNDE LHADGMKRRA LPCIIGEYQG FQGYVHFAKL  180
SPSGLPLKTH CIEDPPLQLS IDSSSASDIE EDGDGVWSIV GGKASCRRNF SLDVTLLDAF  240
DQPLNKEMEV VASLLYADNN EPVPETNDGE APLLTSYDGI EYASSDRPSK LISGRASFKL  300
KMSQLSSKCD NRLFRIRFEI PKIRYPFLEA FSPPIRCISR SRNARASSIT LKKLPSGVHL  360
LNGSQSPGLD DRSSELLNSV VREAKPSPSS KRVKLGQEKP FEIFADSFTS KRADKECKSY  420
AFTTTEGNHT YGSNLVRKPE NHDGSDNFSS DSETSETTKS DLMSIPSSTN QLSDMVVFKY  480
CLGGLSERAV LLKEIALSAR EEELVKFADQ VSLFSGCSHH RHQIMIAKRL IEEGIEAWNL  540
ISQKNDHVLW ENLLSGVKEH FVKIVPCGTR SLTHQDVELL RGISGCQELV SQDHFEKMWF  600
WLYPVALSLS QVWINALWSS VSPKWIEGFI TKEEAESSLQ GPGGFQEPGT FVLRFPTSRS  660
WPHPDAGNLV ITYIGSDYAI HHRLLSLDLM YSSRDRTVRP LQDMLLEEPE LSRLGRHDIF  720
Y*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027062585.10.0SH2 domain-containing protein A-like
TrEMBLA0A068UD020.0A0A068UD02_COFCA; Uncharacterized protein
STRINGSolyc07g062050.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA93942325
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B