PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc04_g09080
Common NameGSCOC_T00022785001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family MYB
Protein Properties Length: 273aa    MW: 31978.7 Da    PI: 7.3577
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc04_g09080genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53e-18449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+++G+++W++Ia++++ gR++k+c++rw++ 
      Cc04_g09080  4 RGHWRPAEDEKLRELVEKYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding53.55.5e-175699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r ++T+eE+ell+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
      Cc04_g09080 56 RSPFTEEEEELLLASHRIHGNR-WAIIARLFP-GRTDNAVKNHWHV 99
                     789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.727154IPR017930Myb domain
SMARTSM007177.1E-16352IPR001005SANT/Myb domain
PfamPF002495.6E-18449IPR001005SANT/Myb domain
SuperFamilySSF466892.51E-30497IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-28557IPR009057Homeodomain-like
CDDcd001675.35E-14748No hitNo description
PROSITE profilePS5129421.11755105IPR017930Myb domain
SMARTSM007171.3E-1555103IPR001005SANT/Myb domain
PfamPF002495.0E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2058104IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MCSRGHWRPA EDEKLRELVE KYGPHNWNAI AEKLQGRSGK SCRLRWFNQL DPRINRSPFT  60
EEEEELLLAS HRIHGNRWAI IARLFPGRTD NAVKNHWHVI MARRCRERSK MYAKRAAQAS  120
RTDQQKPESP KQDMQASSNQ IKCSFSPILF ENNYSQRLHQ YPLTFSTCSP YLKELLSQKH  180
IHDMNMSRDK DKNEPVEFYD FLQVNADSNR SEVIDNVARK EDEEVEQESI MEHDHQAKTG  240
VPLIDFFSAG GDQYSEIRSE GCNYNHSEKV YY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-3441057108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027121706.10.0transcription factor MYB54-like
SwissprotQ6R0C41e-84MYB52_ARATH; Transcription factor MYB52
TrEMBLA0A068TRJ20.0A0A068TRJ2_COFCA; Uncharacterized protein
STRINGPOPTR_0015s05130.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.15e-87myb domain protein 52
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Cassan-Wang H, et al.
    Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis.
    Front Plant Sci, 2013. 4: p. 189
    [PMID:23781226]
  3. Shi D, et al.
    MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage.
    Plant Physiol., 2018. 176(4): p. 2737-2749
    [PMID:29440562]