PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc02_g24390
Common NameGSCOC_T00028891001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family GRAS
Protein Properties Length: 817aa    MW: 88018.1 Da    PI: 6.3575
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc02_g24390genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS334.32.3e-1024578152374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfsevsPilkfshlt 97 
                  +++L+++Ae v++g+  laq +Larl+++ sp g+p+qR+a+y +eAL+  l+       + l+p +++++    + ++ a+k fse+sP+++f+++t
  Cc02_g24390 457 IDQLYKAAELVQTGNPLLAQGILARLNHQLSPIGKPFQRAAFYCKEALQLLLHT------NNLNPCTANSSPfsLIFKIGAYKSFSEISPVVQFANFT 548
                  689**************************************************9......344333333333349*********************** PP

         GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele.eL 194
                  + qa+le +eg +r+HiiDfdi++G+QW++++q+La R++g+pslRiT+++sp+++++ el  ++e+L +fA+e+++ fef+++  ++l++ + +  L
  Cc02_g24390 549 CIQALLEVLEGFDRIHIIDFDIGYGGQWASFMQELALRSGGAPSLRITAFASPSTHDQLELGLMRENLMHFASEINMAFEFEIVSIDSLNSASWSlPL 646
                  ***********************************************************************************988888888665358 PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  +v+++Ea+aVnl ++ ++    +++l    + +L++vk+lsPk+vv v++ +++++ +F +++++al+ ys l++sl+a    + +  +k+Er+ll++
  Cc02_g24390 647 HVSENEAIAVNLPVSSFSSC--QLPL----SLILRFVKQLSPKIVVSVDRGCNRTDLPFPNHVIHALQSYSNLLESLDAV-NVNLDSLQKIERFLLQP 737
                  9*************888887..4444....45*********************************************665.34668889********* PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                   i+ ++  +  +     e+ ++Wr  + ++GF+p+++s+++++qa++++++++++g++ve+++ +lvl+W++++L+s+SaWr
  Cc02_g24390 738 GIERILLGRYHS----PEKTQHWRTLFLSSGFSPLTFSNFTESQAECVVKRTPVRGFHVEKRQSALVLCWQRKELISASAWR 815
                  *******99998....9****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.96430795IPR005202Transcription factor GRAS
PfamPF035147.9E-100457815IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
MKGMPLPFDF QGKGVLDLDL QFVSSSSSSS SSSSFWNYKN ASNCKANCLL NRNTSISSDS  60
EPTSVLDNIR SQSPPTSSST LSSSLGGGGG GGGPNKNSGG AVAGGGGGAS TDTTGVAAVS  120
GNSSIKWHQD APSTTTSSNV AAESELQPVP PSLEMGGGGT TAAEEWESVL PESVAASPSQ  180
EQSILRWIMG DVDDPSMANL NKVLQIGGGP AAADDEFNPG FGVVDQGFGA DPVGQVTNFL  240
PPMNPSLPMA SSASLSSNRV NGEKIGLLAN SSGSPAVNKL SNPQNSIFPA LSSNLGVPIA  300
FNQGQQHVIQ QTPTAAFECA EMKPPIFNPQ MLINQHQAQH PQNPSFFMPL AYGQQEQNLL  360
MPPQSKRHNP GHIGGTDPGF QISKAPFSDT GQELFAGRQQ PHQQQQAMPQ GLSHQLQLLP  420
HYLQQRPAAT SPKQKMIGDE MGHSHQQQQQ QQQQAIIDQL YKAAELVQTG NPLLAQGILA  480
RLNHQLSPIG KPFQRAAFYC KEALQLLLHT NNLNPCTANS SPFSLIFKIG AYKSFSEISP  540
VVQFANFTCI QALLEVLEGF DRIHIIDFDI GYGGQWASFM QELALRSGGA PSLRITAFAS  600
PSTHDQLELG LMRENLMHFA SEINMAFEFE IVSIDSLNSA SWSLPLHVSE NEAIAVNLPV  660
SSFSSCQLPL SLILRFVKQL SPKIVVSVDR GCNRTDLPFP NHVIHALQSY SNLLESLDAV  720
NVNLDSLQKI ERFLLQPGIE RILLGRYHSP EKTQHWRTLF LSSGFSPLTF SNFTESQAEC  780
VVKRTPVRGF HVEKRQSALV LCWQRKELIS ASAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3247181518375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027106490.10.0scarecrow-like protein 6
TrEMBLA0A068UMM30.0A0A068UMM3_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000667990.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-147GRAS family protein