PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cc02_g14960 | ||||||||
Common Name | GSCOC_T00013922001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 174aa MW: 19191.4 Da PI: 9.1429 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 125.2 | 2e-39 | 39 | 97 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk+k Cc02_g14960 39 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKNCQRYWTAGGALRNVPVGAGRRKSKP 97 68999***************************************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 4.0E-29 | 38 | 96 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 2.6E-32 | 41 | 96 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.602 | 43 | 97 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 45 | 81 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010214 | Biological Process | seed coat development | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MAESGGGIKL FGATIAVQVR QAKDEGNKGE EQQTVEKRPD KIIPCPRCKS METKFCYFNN 60 YNVNQPRHFC KNCQRYWTAG GALRNVPVGA GRRKSKPPGR GFVAGLSDGC SLFDDASGVV 120 HQFEFDHHHH GVVEEWHVAA EHGDFQHIFP AKRRRSSTSS NSQPRSSSTL SCS* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269|PubMed:19619493}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00166 | DAP | Transfer from AT1G29160 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP662920 | 2e-36 | KP662920.1 Cajanus cajan Dof34 (Dof34) gene, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027101453.1 | 1e-109 | cyclic dof factor 4-like | ||||
Refseq | XP_027115652.1 | 1e-109 | cyclic dof factor 4-like | ||||
Refseq | XP_027163834.1 | 1e-109 | cyclic dof factor 4 | ||||
Swissprot | P68350 | 9e-58 | DOF15_ARATH; Dof zinc finger protein DOF1.5 | ||||
TrEMBL | A0A068TLE4 | 1e-127 | A0A068TLE4_COFCA; Uncharacterized protein | ||||
STRING | EOY28004 | 1e-70 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7240 | 22 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 3e-52 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|