PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc02_g09550
Common NameGSCOC_T00029643001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family MYB
Protein Properties Length: 232aa    MW: 26437.2 Da    PI: 6.9028
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc02_g09550genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.82.9e-093073344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      WT+ Ed+l+ +a   ++ +   +W +Ia +++ g+t+++++ ++
      Cc02_g09550 30 TWTKYEDKLFEQALVGFPEDlpnRWQKIADRVP-GKTAEDVRVHY 73
                     6*************9999999999*********.********998 PP

2Myb_DNA-binding41.72.7e-13138182347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G g+W++I+r +  +Rt+ q+ s+ qky
      Cc02_g09550 138 PWTEEEHRLFLIGLDRYGRGDWRSISRNVVVTRTPTQVASHAQKY 182
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007177.4E-72779IPR001005SANT/Myb domain
SuperFamilySSF466892.9E-113083IPR009057Homeodomain-like
CDDcd001676.19E-83073No hitNo description
PfamPF002494.1E-83073IPR001005SANT/Myb domain
PROSITE profilePS500907.1083177IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.6E-53174IPR009057Homeodomain-like
PROSITE profilePS5129420.283131187IPR017930Myb domain
SuperFamilySSF466891.66E-16133187IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-16134186IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.0E-11135181IPR009057Homeodomain-like
SMARTSM007174.5E-10135185IPR001005SANT/Myb domain
CDDcd001676.98E-9138182No hitNo description
PfamPF002492.8E-11138182IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MYNSPNDGNN NTNQSWVMYN SAPPHPPVVT WTKYEDKLFE QALVGFPEDL PNRWQKIADR  60
VPGKTAEDVR VHYDALVHDV REIEAGRVEL PNYADEDEFF GWGEPEQPPP ESRTPNQISF  120
GASGKAKHGD GERKKGTPWT EEEHRLFLIG LDRYGRGDWR SISRNVVVTR TPTQVASHAQ  180
KYYLRQTSGK KERKRSSIHD ITTPLESKTV APPSNFPNQA GYQNFSFPEQ R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-1431931173RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027104730.11e-169transcription factor DIVARICATA-like
RefseqXP_027111292.11e-169transcription factor DIVARICATA
RefseqXP_027161713.11e-169transcription factor DIVARICATA
SwissprotQ8S9H72e-57DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A068TV401e-171A0A068TV40_COFCA; Uncharacterized protein
STRINGXP_009796939.11e-89(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-73MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]