PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc01_g07440
Common NameGSCOC_T00030182001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family MYB
Protein Properties Length: 523aa    MW: 56969.5 Da    PI: 5.9703
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc01_g07440genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.7e-183986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lv++v+++G g+W+++ ++ g+ R++k+c++rw ++l
      Cc01_g07440 39 KGPWTSAEDAILVEYVTKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 86
                     79******************************************9986 PP

2Myb_DNA-binding52.31.3e-1692135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ +++++++++G++ W++ a++++ gRt++++k++w++
      Cc01_g07440  92 KGAFTPEEERRIIELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 135
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5813486IPR017930Myb domain
SuperFamilySSF466893.26E-3037133IPR009057Homeodomain-like
SMARTSM007171.7E-133888IPR001005SANT/Myb domain
PfamPF002493.9E-153986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-244093IPR009057Homeodomain-like
CDDcd001674.87E-114186No hitNo description
PROSITE profilePS5129426.47487141IPR017930Myb domain
SMARTSM007171.8E-1691139IPR001005SANT/Myb domain
PfamPF002491.5E-1592135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-2694140IPR009057Homeodomain-like
CDDcd001673.78E-1294135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MSMTSESEDR MVPKGAIGSP SIEETSGGGN FGVNGPLKKG PWTSAEDAIL VEYVTKHGEG  60
NWNAVQKHSG LARCGKSCRL RWANHLRPDL KKGAFTPEEE RRIIELHAKM GNKWARMAAE  120
LPGRTDNEIK NYWNTRIKRR QRAGLPIYPP DICLQALSES KQSENLSSFS SVETQHPDLL  180
PINSFEIPAV EFKNLELNHQ LYPSPLLDVP GRGLLDIPAS SLLAQGLHSS YGGKTLLSAV  240
HPTKRLRQSE SLFPGLATSF TGAFTNCSKY HNDGSAQSLQ SFGITSAYDQ NLTSDNHSTS  300
CVLPGSHALL NGNPSSSEPS WAMKLELPSL QTQIGSWGSP SSPLPSLESV DTLIQSPPTE  360
HTQSGSLSPR NSGLLDAVLY ESQSLKNFKS SSCQHMSSVS MAQGEVMDNS LQDLHEAEWE  420
AYGDPISPRG HSAASVLSEY TPISRSSMDE LQSLENTPGG KVKQEAEEMV PTQFCGNDDA  480
FNSNNMIFSR PDFLLASNCF GPKGEYGKEQ LHAERCSWGT SW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31371405107B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. {ECO:0000269|PubMed:9150608}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By gibberellin in aleurone cells. {ECO:0000269|PubMed:9150608}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027081255.10.0transcription factor GAMYB-like
SwissprotA2WW871e-102GAM1_ORYSI; Transcription factor GAMYB
TrEMBLA0A068UQ740.0A0A068UQ74_COFCA; Uncharacterized protein
STRINGXP_009786742.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.19e-88myb domain protein 33