PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ciclev10033714m

Common Name

CICLE_v10033714mg

Organism

Citrus clementina

Taxonomic ID

85681

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

YABBY

Protein Properties

Length: 160aa MW: 18079.6 Da PI: 6.7725

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ciclev10033714m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	195.4	2.6e-60	6	160	2	159
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakas....qllaaeshldeslkeelleelkveeenlksnvekees 91 ++f+ +eq+CyvqC+fC+til+vsvP +s+++vvtvrCGhCtsllsvn++kas +lla+ sh +e +ee ++ee + +++ ++ s Ciclev10033714m 6 HLFDLPEQICYVQCGFCTTILLVSVPCSSMSMVVTVRCGHCTSLLSVNMMKASfvplHLLASFSH-----DDEPKEEFRKEEVQADQKAFNRFS 94 7899********************************************999777788888888.....344455555555556666666666 PP YABBY 92 astsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaakn 159 +s +ss + +e++ + + v++PPe+rqr+Psaynrfikeei+r+k++nP+++h+eafs+aakn Ciclev10033714m 95 PSILTSSDNEEEDTGSVIN--HVVNKPPERRQRAPSAYNRFIKEEIRRLKTENPNMAHKEAFSTAAKN 160 7777777553444444444..4699****************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	2.2E-58	11	160	IPR006780	YABBY protein
SuperFamily	SSF47095	8.51E-7	114	157	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	4.3E-4	118	158	IPR009071	High mobility group box domain
CDD	cd00084	5.30E-4	125	152	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009944	Biological Process	polarity specification of adaxial/abaxial axis
GO:0048481	Biological Process	plant ovule development
GO:0005634	Cellular Component	nucleus

Sequence ? help Back to Top
Protein Sequence Length: 160 aa Download sequence Send to blast
MSALNHLFDL PEQICYVQCG FCTTILLVSV PCSSMSMVVT VRCGHCTSLL SVNMMKASFV 60 PLHLLASFSH DDEPKEEFRK EEVQADQKAF NRFSPSILTS SDNEEEDTGS VINHVVNKPP 120 ERRQRAPSAY NRFIKEEIRR LKTENPNMAH KEAFSTAAKN

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: First detected in a group of around 15 epidermal cells on the abaxial half of each ovule primordium (chalaza, outer integument initiation sites). Later present in the outer cell layer of the outer integument on the abaxial side of the ovule primordium. Confined to the chalazal end of the integument and disappears after anthesis. Also present in embryos at the globular stage. {ECO:0000269\|PubMed:10601041, ECO:0000269\|PubMed:12183380, ECO:0000269\|PubMed:12183381}.

Functional Description ? help Back to Top
Source	Description
UniProt	Essential for the formation and the abaxial-adaxial asymmetric growth of the ovule outer integument. {ECO:0000269\|PubMed:10601041, ECO:0000269\|PubMed:12183380, ECO:0000269\|PubMed:9093862, ECO:0000269\|PubMed:9118807}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Autoinduction down-regulated by SUP in adaxial region of the ovule outer integument. Negatively and spatially regulated by HLL, ANT, BELL1, NZZ/SPL and SUP. {ECO:0000269\|PubMed:10601041, ECO:0000269\|PubMed:12183380, ECO:0000269\|PubMed:12183381}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006438330.2	1e-116	axial regulator YABBY 4 isoform X2
Refseq	XP_006483897.1	1e-116	axial regulator YABBY 4
Swissprot	Q9LDT3	2e-65	YAB4_ARATH; Axial regulator YABBY 4
TrEMBL	V4TIT8	1e-115	V4TIT8_9ROSI; Uncharacterized protein (Fragment)
STRING	XP_006483897.1	1e-115	(Citrus sinensis)
STRING	XP_006438330.1	1e-116	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM8044	27	40

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G23420.1	6e-58	YABBY family protein

Link Out ? help Back to Top
Phytozome	Ciclev10033714m
Entrez Gene	18043359

Publications ? help Back to Top
Lora J,Hormaza JI,Herrero M Transition from two to one integument in Prunus species: expression pattern of INNER NO OUTER (INO), ABERRANT TESTA SHAPE (ATS) and ETTIN (ETT). New Phytol., 2015. 208(2): p. 584-95 [PMID:25991552] Skinner DJ,Brown RH,Kuzoff RK,Gasser CS Conservation of the role of INNER NO OUTER in development of unitegmic ovules of the Solanaceae despite a divergence in protein function. BMC Plant Biol., 2016. 16(1): p. 143 [PMID:27350128] Simon MK,Skinner DJ,Gallagher TL,Gasser CS Integument Development in Arabidopsis Depends on Interaction of YABBY Protein INNER NO OUTER with Coactivators and Corepressors. Genetics, 2017. 207(4): p. 1489-1500 [PMID:28971961]