PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10024451m | ||||||||
Common Name | CICLE_v10024451mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | ERF | ||||||||
Protein Properties | Length: 126aa MW: 14324.9 Da PI: 5.3658 | ||||||||
Description | ERF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | AP2 | 58.3 | 1.9e-18 | 19 | 70 | 2 | 55 |
AP2 2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55 +y+GVr+++ +g+++AeIrd + g r +lg+f taeeAa+a+++a+ +++g Ciclev10024451m 19 RYRGVRRRP-WGKFAAEIRDSTRHG-APRLWLGTFTTAEEAARAYDRAAFAMRG 70 6********.**********43333.5*************************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF54171 | 1.7E-21 | 19 | 79 | IPR016177 | DNA-binding domain |
Pfam | PF00847 | 9.3E-14 | 19 | 70 | IPR001471 | AP2/ERF domain |
Gene3D | G3DSA:3.30.730.10 | 7.1E-30 | 19 | 79 | IPR001471 | AP2/ERF domain |
SMART | SM00380 | 1.8E-33 | 19 | 84 | IPR001471 | AP2/ERF domain |
PROSITE profile | PS51032 | 23.406 | 19 | 78 | IPR001471 | AP2/ERF domain |
CDD | cd00018 | 1.77E-27 | 19 | 79 | No hit | No description |
PRINTS | PR00367 | 4.3E-11 | 20 | 31 | IPR001471 | AP2/ERF domain |
PRINTS | PR00367 | 4.3E-11 | 44 | 60 | IPR001471 | AP2/ERF domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MEKVGRRSKE KEEEATSVRY RGVRRRPWGK FAAEIRDSTR HGAPRLWLGT FTTAEEAARA 60 YDRAAFAMRG PTAVLNFPNE HFLSGKVERG GGTNEGEKEV FEIEYLDDQL LEDLLNFDDD 120 KTKND* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5wx9_A | 3e-31 | 19 | 110 | 14 | 114 | Ethylene-responsive transcription factor ERF096 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006443852.1 | 3e-87 | ethylene-responsive transcription factor ERF098 | ||||
Swissprot | Q9LTC5 | 8e-36 | ERF98_ARATH; Ethylene-responsive transcription factor ERF098 | ||||
TrEMBL | V4TUB9 | 8e-86 | V4TUB9_9ROSI; Uncharacterized protein | ||||
STRING | XP_006443852.1 | 1e-86 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM10 | 28 | 1650 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G04370.1 | 4e-22 | Ethylene-responsive element binding factor 14 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10024451m |
Entrez Gene | 18046783 |
Publications ? help Back to Top | |||
---|---|---|---|
|