PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10019120m
Common NameCICLE_v10019120mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family STAT
Protein Properties Length: 694aa    MW: 77786.3 Da    PI: 6.111
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10019120mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT191.21.1e-592153331119
             STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkk 94 
                      ldvvllna+gqpv+k+ve+ a+Llyad+g++vek++d eapLL+sydG+ef+++drp+kll+G+asfklkisqLsskcdnrLf+i+fe+pkl  
  Ciclev10019120m 215 LDVVLLNAFGQPVNKEVEITAALLYADNGSLVEKTSDGEAPLLTSYDGIEFPTYDRPSKLLNGCASFKLKISQLSSKCDNRLFCIRFEVPKLVG 308
                      8********************************************************************************************* PP

             STAT  95 ypfleavskpirCisrsrntrsssl 119
                      +pfle++s pirCisr+r+ r+ s+
  Ciclev10019120m 309 FPFLEVLSYPIRCISRTRTIRTFSV 333
                      ********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498994.17E-823137IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:3.30.505.105.9E-6591649IPR000980SH2 domain
SuperFamilySSF555503.2E-7597664IPR000980SH2 domain
PROSITE profilePS500019.574599693IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 694 aa     Download sequence    Send to blast
MGENVIKGED YYLLKDLRFK IEGDEEGFSL CFWVYLMKST TFSATLISQV DIGGNAPFLA  60
LNEKKILMLF PFISLHKEAP DPGKSAPLTE LQHASMDTEF PLESWIHVGC RVSTDSVQLH  120
IDGEIVAEKP VSSSFCKGSL SNSRTRITLV GSNMQGYVHD AKILPLNLSI KDHYHKDPPL  180
LLSIDTSSAS EIEEDSDGVW SIVGGKASCR RIFSLDVVLL NAFGQPVNKE VEITAALLYA  240
DNGSLVEKTS DGEAPLLTSY DGIEFPTYDR PSKLLNGCAS FKLKISQLSS KCDNRLFCIR  300
FEVPKLVGFP FLEVLSYPIR CISRTRTIRT FSVPFKRTPA SIHPTNGSQS CGFDDGSLEI  360
HHNTVLEAKP SPSSKRVRLE QEKISAMEQL DGEGSPHPLT ANKAEGAFAK GLDGTHENTE  420
DADVSPADYE SKGVRNVALK NSGKSVSDLT IFKYCLGGLA DRSHLLKEIV TSFSDEEILE  480
FAHQVSIYTG CSHHRFQIMI AKRLIEEGRN AWNLISQNNP HVHWDCAVFE IEEQFKKISC  540
CSTRPLSHQD FELLRRIAGC RDFLAQENFE KLWCWLYPVA FTLSSDWINK PWRSTSPKWI  600
EGFITKEEAE YSLQGPRGLQ EPGTFVLRFP TSRSWPHPDA GSLIVTYVGS DYTLHHRQVS  660
SDYIYRDMDV KPLQDLLFTE PELSRLGRIV RIH*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.205120.0abscission zone
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers. {ECO:0000269|PubMed:15073273}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006442321.10.0SH2 domain-containing protein A isoform X1
SwissprotQ56XZ10.0SHB_ARATH; SH2 domain-containing protein B
TrEMBLV4U0620.0V4U062_9ROSI; Uncharacterized protein
STRINGXP_006442321.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52052645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B
Publications ? help Back to Top
  1. Yamada Y,Wang HY,Fukuzawa M,Barton GJ,Williams JG
    A new family of transcription factors.
    Development, 2008. 135(18): p. 3093-101
    [PMID:18701541]