PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10017556m | ||||||||
Common Name | CICLE_v10017556mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 225aa MW: 25465.4 Da PI: 8.5752 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 43.6 | 6.6e-14 | 21 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd+llvd+vk +G+g+W++ ++R++k+c++rw +yl Ciclev10017556m 21 KGLWTVEEDKLLVDYVKVHGKGQWNR------LKRCGKSCRLRWMNYL 62 678***********************......78************97 PP | |||||||
2 | Myb_DNA-binding | 63.3 | 4.9e-20 | 68 | 113 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+eEd+l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l Ciclev10017556m 68 RGNFTEEEDDLIIRLHKLLGNR-WALIAKRVP-GRTDNQVKNYWNSHL 113 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.165 | 16 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.08E-28 | 19 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.3E-9 | 20 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-11 | 21 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.1E-19 | 22 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.61E-10 | 24 | 62 | No hit | No description |
PROSITE profile | PS51294 | 29.224 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 1.9E-19 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.5E-19 | 68 | 113 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.16E-14 | 70 | 113 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.5E-28 | 70 | 117 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048765 | Biological Process | root hair cell differentiation | ||||
GO:0090377 | Biological Process | seed trichome initiation | ||||
GO:0090378 | Biological Process | seed trichome elongation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 225 aa Download sequence Send to blast |
MTKTKAKEGQ EEKHDDQYYK KGLWTVEEDK LLVDYVKVHG KGQWNRLKRC GKSCRLRWMN 60 YLSPNVNRGN FTEEEDDLII RLHKLLGNRW ALIAKRVPGR TDNQVKNYWN SHLSKKLGIK 120 DQTRGVGDSP SLTQSQKIQP ITDQNANAII DPCDENTKSY SIDNGTQKAV NVSGSGTQES 180 NTTDESFINS LWNSCDDDLD LGFCRSAHTL TCKVNSLKSS TQTH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-30 | 21 | 117 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to roots and hypocotyl. Specifically expressed in root non-hair developing cells (atrichoblasts) at the N position. Also present in lateral root cap cells. In hypocotyls, expressed within files of epidermal cells located outside a single cortical cell equivalent to roots N cells (at protein level). {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:16207757}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JF487811 | 3e-45 | JF487811.1 Mangifera indica clone Mgd16 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024047677.1 | 1e-147 | transcription factor WER | ||||
Swissprot | Q9SEI0 | 7e-66 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | V4UBY3 | 1e-166 | V4UBY3_9ROSI; Uncharacterized protein | ||||
STRING | XP_006446506.1 | 1e-166 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 3e-68 | myb domain protein 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10017556m |
Entrez Gene | 18050685 |