PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10012022m
Common NameCICLE_v10012022mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family CO-like
Protein Properties Length: 366aa    MW: 39981.4 Da    PI: 6.5004
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10012022mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.51.8e-051859439
         zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                     r+C+++     + +C+ +  +lC  C +  H        H++
  Ciclev10012022m 18 RVCDTCRAAACTVYCKADMAYLCSACDSRVHVAnrvafrHER 59
                     79******99******************99944456666765 PP

2zf-B_box32.12.3e-1061105442
         zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                       +C+ +e+ ++ + C+ +   lC+ C  e+H+       H++vp+
  Ciclev10012022m  61 FVCESCEQAPAAFLCKADAASLCAACDAEIHSAnplarrHQRVPI 105
                      68*****************************66899999**9997 PP

3CCT70.44.4e-24296339144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Ciclev10012022m 296 REARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT 339
                      9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.7E-61562IPR000315B-box-type zinc finger
PROSITE profilePS5011910.2241562IPR000315B-box-type zinc finger
CDDcd000213.39E-71862No hitNo description
PROSITE profilePS5011911.60458105IPR000315B-box-type zinc finger
CDDcd000215.35E-961105No hitNo description
PfamPF006433.9E-861105IPR000315B-box-type zinc finger
SMARTSM003363.0E-1163105IPR000315B-box-type zinc finger
PfamPF062037.0E-18296338IPR010402CCT domain
PROSITE profilePS5101716.648296338IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MMKEESNDGS GGGNSWARVC DTCRAAACTV YCKADMAYLC SACDSRVHVA NRVAFRHERV  60
FVCESCEQAP AAFLCKADAA SLCAACDAEI HSANPLARRH QRVPILPISG SVYGGRTGAT  120
PEGHHEDDQD EEEAASWLLL SNPGKNCGNG NNGNNNGFLF GGEVDEYLDL VDYTGGNQYL  180
DQYSTGNNNQ QQHGVAQKGY VGDSVVPVQC ELANKDHHRH QQNFQLGLDY DSSKAGYSYN  240
GSISHSVSVS STDLGVVPES TMSDISISHS RPPKGTIDLF SGPPIQMPPQ LTPMDREARV  300
LRYREKKKTR KFEKTIRYAS RKAYAETRPR IKGRFAKRTD AEVEVDQMFS ATLMTDPGYG  360
IVPSF*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed throughout development.
UniprotTISSUE SPECIFICITY: Highly expressed in leaves. Expressed at lower levels in stems, flowers and siliques. Not detected in roots.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Does not affect flowering time.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ3732071e-166FJ373207.1 Poncirus trifoliata CO-like protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430882.10.0zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-151COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLV4STR50.0V4STR5_9ROSI; Uncharacterized protein
STRINGXP_006430882.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-105CONSTANS-like 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]