PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10010621m | ||||||||
Common Name | CICLE_v10010621mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 195aa MW: 21576.3 Da PI: 9.0197 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.8 | 9.2e-17 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 rg+W++eEd l+++v+ +G+g +W + +++ g++R++k+c++rw++yl Ciclev10010621m 14 RGPWSPEEDATLKRYVETHGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 62 89*********************************************97 PP | |||||||
2 | Myb_DNA-binding | 42.5 | 1.5e-13 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g++T++Ed + + q G++ W+ Ia++++ gRt++++k++w++ Ciclev10010621m 69 GNFTEDEDHVICTLYSQIGSR-WSIIASRLP-GRTDNDVKNYWNT 111 89*******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.863 | 9 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.6E-28 | 11 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.1E-12 | 13 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.8E-16 | 14 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-25 | 15 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.95E-10 | 16 | 62 | No hit | No description |
PROSITE profile | PS51294 | 22.257 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 5.5E-11 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.2E-12 | 69 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.01E-8 | 70 | 111 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 9.5E-24 | 70 | 117 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MGRAPCCDKA NVKRGPWSPE EDATLKRYVE THGTGGNWIA LPQKAGLKRC GKSCRLRWLN 60 YLRPDIKHGN FTEDEDHVIC TLYSQIGSRW SIIASRLPGR TDNDVKNYWN TKLKKKLLAG 120 KVSLLTSNNA NNSPIISGSN PTDTNHLHDS NPSISLPKSE ACDPQYPASP TQLSSSPSMP 180 LLTDHHDHIA YGLST |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-24 | 14 | 117 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Accumulates in an adaxial ball-shaped set of cells in three to five cell layers around the L3 layer of the shoot apical meristem (SAM) in youg plantlets. In the inflorescence meristem, confined to the axils of flower primordia. {ECO:0000269|PubMed:16461581}. | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16461581}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (By similarity). Positively regulates axillary meristems (AMs) formation and development, especially during inflorescence. {ECO:0000250, ECO:0000269|PubMed:16461581}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006450765.2 | 1e-143 | transcription factor MYB87 | ||||
Refseq | XP_006475979.1 | 1e-143 | transcription factor MYB87-like | ||||
Swissprot | Q9M2Y9 | 6e-72 | RAX3_ARATH; Transcription factor RAX3 | ||||
TrEMBL | A0A067GJZ7 | 1e-142 | A0A067GJZ7_CITSI; Uncharacterized protein (Fragment) | ||||
TrEMBL | A0A2H5Q7G8 | 1e-141 | A0A2H5Q7G8_CITUN; Uncharacterized protein | ||||
TrEMBL | V4UIF3 | 1e-142 | V4UIF3_9ROSI; Uncharacterized protein (Fragment) | ||||
STRING | XP_006475979.1 | 1e-142 | (Citrus sinensis) | ||||
STRING | XP_006450765.1 | 1e-143 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49690.1 | 2e-74 | myb domain protein 84 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10010621m |
Entrez Gene | 18055104 |
Publications ? help Back to Top | |||
---|---|---|---|
|