PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10009336m | ||||||||
Common Name | CICLE_v10009336mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 239aa MW: 26149 Da PI: 4.7123 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.9 | 8.6e-17 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 rg+W++eEd +l+++ +q+G+g +W + +++ g++R++k+c++rw++yl Ciclev10009336m 14 RGPWSAEEDSILKNYLEQFGNGgNWIALPKKAGLNRCGKSCRLRWLNYL 62 89*********************************************97 PP | |||||||
2 | Myb_DNA-binding | 40.1 | 8.8e-13 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g +T+eEd ++ ++ +G++ W+ Ia+ ++ gRt++++k++w++ Ciclev10009336m 69 GGFTKEEDTIICNLYCTMGSR-WSVIASQLP-GRTDNDVKNYWNT 111 569******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.806 | 9 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.62E-27 | 11 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.0E-12 | 13 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.7E-15 | 14 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-23 | 15 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.97E-9 | 16 | 62 | No hit | No description |
PROSITE profile | PS51294 | 19.223 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 1.7E-11 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.4E-11 | 69 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.0E-23 | 70 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.42E-9 | 71 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 239 aa Download sequence Send to blast |
MGRAPCCDKA NVKRGPWSAE EDSILKNYLE QFGNGGNWIA LPKKAGLNRC GKSCRLRWLN 60 YLRPDIKHGG FTKEEDTIIC NLYCTMGSRW SVIASQLPGR TDNDVKNYWN TKLKKNVLAG 120 KLSDNTQVSV STIPEEFGNS SYYLSADSAA GMIFDPSANS NYGNKMTSTT QEAAAASSLS 180 ISSSSSTLEN NYDLRSANGN VEDEGILLDD FDFEYSYELL NGFDFEKASN EVAQCLGG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-25 | 14 | 117 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In roots, expressed in endodermal cells from the late elongation zones to the differentiation zone and, to a lower extent, in endodermal cells of the meristematic zone. {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves, roots (endodermis-specific) and seedlings. {ECO:0000269|PubMed:16461581, ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322, ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006475368.1 | 1e-161 | transcription factor MYB36-like | ||||
Refseq | XP_024034257.1 | 1e-161 | transcription factor MYB36 | ||||
Swissprot | Q9FKL2 | 1e-69 | MYB36_ARATH; Transcription factor MYB36 | ||||
TrEMBL | A0A067ELE3 | 1e-175 | A0A067ELE3_CITSI; Uncharacterized protein | ||||
TrEMBL | V4TVL8 | 1e-175 | V4TVL8_9ROSI; Uncharacterized protein | ||||
STRING | XP_006451363.1 | 1e-176 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G65790.1 | 3e-71 | myb domain protein 68 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10009336m |
Entrez Gene | 18056157 |
Publications ? help Back to Top | |||
---|---|---|---|
|