PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10006695m | ||||||||
Common Name | CICLE_v10005465mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 173aa MW: 19885.3 Da PI: 8.7629 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 158.5 | 2.7e-49 | 24 | 152 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 pGfrFhPtdeelv +yL++kv++k+l++ e ik++diyk++PwdLpk ++ ++e yfF+kr +ky+++ r+nr+t sg+Wkatg dk+v+s Ciclev10006695m 24 LPGFRFHPTDEELVGFYLRRKVDKKPLSI-ELIKQIDIYKHDPWDLPKISSTPDNEGYFFCKRGRKYRNSVRPNRVTGSGFWKATGIDKPVYSD 116 59***************************.89***************777778899*************************************9 PP NAM 96 ...kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ +glkktLv+y+g+a kg+ktdW+m+e+rl Ciclev10006695m 117 ggeGQDCIGLKKTLVYYRGTAGKGTKTDWMMNEFRL 152 6655555***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.92E-52 | 23 | 162 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 47.306 | 23 | 173 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.2E-25 | 25 | 152 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MNGQNIKIDH HCYRDDHEAD DHQLPGFRFH PTDEELVGFY LRRKVDKKPL SIELIKQIDI 60 YKHDPWDLPK ISSTPDNEGY FFCKRGRKYR NSVRPNRVTG SGFWKATGID KPVYSDGGEG 120 QDCIGLKKTL VYYRGTAGKG TKTDWMMNEF RLPSDDRSGN TNVTNAKTTL PEA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 1e-43 | 16 | 152 | 8 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, root caps, cotyledons, tips and margin of young leaves, senescent regions of fully expanded leaves and floral tissues, including old sepals, petals, staments, mature anthers and pollen grains. Not detected in the abscission zone of open flowers, emerging lateral roots and root meristematic zones. {ECO:0000269|PubMed:22345491}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006475534.2 | 1e-129 | transcription factor JUNGBRUNNEN 1-like | ||||
Swissprot | Q9SK55 | 8e-74 | NAC42_ARATH; Transcription factor JUNGBRUNNEN 1 | ||||
TrEMBL | A0A2H5MX12 | 1e-127 | A0A2H5MX12_CITUN; Uncharacterized protein | ||||
STRING | XP_006475534.1 | 1e-128 | (Citrus sinensis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM306 | 28 | 200 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G43000.1 | 3e-76 | NAC domain containing protein 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10006695m |
Entrez Gene | 18032929 |