PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10006208m | ||||||||
Common Name | CICLE_v10006208mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 130aa MW: 14197.1 Da PI: 7.8869 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 142.4 | 1.4e-44 | 12 | 111 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 +CaaCk+ rr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++l+e++r++a+ss+vyeA+ar +dPv+G+vg i++lqqq+e+l+a+l Ciclev10006208m 12 PCAACKLIRRRCAQDCVFAPYFPADEPQKFASVHKVFGASNVNKMLQELQEHQRSEAVSSMVYEANARFHDPVRGCVGAISSLQQQVESLQAQL 105 7********************************************************************************************* PP DUF260 95 allkee 100 al+++e Ciclev10006208m 106 ALAQAE 111 **9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.7 | 11 | 112 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.5E-43 | 12 | 109 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
MESGTRQGAL SPCAACKLIR RRCAQDCVFA PYFPADEPQK FASVHKVFGA SNVNKMLQEL 60 QEHQRSEAVS SMVYEANARF HDPVRGCVGA ISSLQQQVES LQAQLALAQA EVEQMRMRLI 120 SPSSSSSHN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-47 | 5 | 112 | 4 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-47 | 5 | 112 | 4 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006422220.1 | 7e-91 | LOB domain-containing protein 4 | ||||
Refseq | XP_006475321.1 | 7e-91 | LOB domain-containing protein 4 isoform X1 | ||||
Swissprot | Q9SHE9 | 1e-57 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
TrEMBL | A0A067F2R8 | 2e-89 | A0A067F2R8_CITSI; Uncharacterized protein | ||||
TrEMBL | V4S9E0 | 2e-89 | V4S9E0_9ROSI; Uncharacterized protein | ||||
STRING | XP_006475321.1 | 3e-90 | (Citrus sinensis) | ||||
STRING | XP_006422220.1 | 3e-90 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31320.1 | 3e-52 | LOB domain-containing protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10006208m |
Entrez Gene | 18033248 |